BLASTX nr result
ID: Papaver31_contig00032900
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00032900 (648 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010100302.1| Cytochrome P450 71A1 [Morus notabilis] gi|58... 60 8e-07 ref|XP_002515012.1| cytochrome P450, putative [Ricinus communis]... 57 7e-06 >ref|XP_010100302.1| Cytochrome P450 71A1 [Morus notabilis] gi|587893904|gb|EXB82436.1| Cytochrome P450 71A1 [Morus notabilis] Length = 417 Score = 60.5 bits (145), Expect = 8e-07 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -3 Query: 643 MPVGIRAEDVNLDEIFGLATRKKTALVLVPTINEDY 536 +P G+ A+DVNLDEIFGLATRKKT L+LVPT N+DY Sbjct: 380 LPQGVGADDVNLDEIFGLATRKKTPLILVPTANKDY 415 >ref|XP_002515012.1| cytochrome P450, putative [Ricinus communis] gi|223546063|gb|EEF47566.1| cytochrome P450, putative [Ricinus communis] Length = 520 Score = 57.4 bits (137), Expect = 7e-06 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = -3 Query: 646 SMPVGIRAEDVNLDEIFGLATRKKTALVLVPTINEDY 536 ++P G+ A+DV+L E+FGLATRKKTALVLVPT N+D+ Sbjct: 477 ALPHGVEADDVDLSEVFGLATRKKTALVLVPTANKDF 513