BLASTX nr result
ID: Papaver31_contig00032871
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00032871 (711 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010255667.1| PREDICTED: probable transcriptional regulato... 60 2e-06 ref|XP_010107401.1| Transcriptional corepressor SEUSS [Morus not... 59 4e-06 >ref|XP_010255667.1| PREDICTED: probable transcriptional regulator SLK2, partial [Nelumbo nucifera] Length = 895 Score = 59.7 bits (143), Expect = 2e-06 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = -3 Query: 121 VLVVALESYLETSHQGTVPPAAPSRVAGGPTNSTSSSGIF 2 +L +AL+SYL++SHQ VPP AP+RVAGGP S+SSSGIF Sbjct: 8 LLGLALDSYLDSSHQSVVPPVAPTRVAGGPAQSSSSSGIF 47 >ref|XP_010107401.1| Transcriptional corepressor SEUSS [Morus notabilis] gi|587928753|gb|EXC15939.1| Transcriptional corepressor SEUSS [Morus notabilis] Length = 994 Score = 58.5 bits (140), Expect = 4e-06 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -3 Query: 118 LVVALESYLETSHQGTVPPAAPSRVAGGPTNSTSSSGIF 2 L +ALESYL++ HQG VPP PSRVAGG T S+SSSGIF Sbjct: 69 LGLALESYLDSGHQGAVPPMVPSRVAGGLTQSSSSSGIF 107