BLASTX nr result
ID: Papaver31_contig00032471
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00032471 (766 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIL54493.1| hypothetical protein M378DRAFT_1055673 [Amanita m... 43 2e-06 >gb|KIL54493.1| hypothetical protein M378DRAFT_1055673 [Amanita muscaria Koide BX008] Length = 1391 Score = 43.1 bits (100), Expect(2) = 2e-06 Identities = 17/30 (56%), Positives = 21/30 (70%) Frame = -1 Query: 358 ASHWMAEKLTSSSLRTPKFGTCCFEGKILI 269 A HW E+LT S+ PKFGTCC +GK+ I Sbjct: 10 ALHWRKERLTRSTNANPKFGTCCLDGKVSI 39 Score = 36.6 bits (83), Expect(2) = 2e-06 Identities = 17/37 (45%), Positives = 21/37 (56%) Frame = -3 Query: 275 PHTRKPPRALRELSNGNDARSTTFRKHVREYK*MFAM 165 P ++PPR L EL NG +ST F H+ Y FAM Sbjct: 40 PSLQEPPRELWELYNGTSLQSTHFLDHINSYNNAFAM 76