BLASTX nr result
ID: Papaver31_contig00032185
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00032185 (788 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB65873.1| hypothetical protein B456_010G132100 [Gossypium r... 60 2e-06 >gb|KJB65873.1| hypothetical protein B456_010G132100 [Gossypium raimondii] Length = 154 Score = 60.1 bits (144), Expect = 2e-06 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -1 Query: 515 NWFQEPSWFEALLGSQSPWTAHQDYWSQR*DCWCL 411 N F EP W EALLGS PW+AHQD+WSQR DC CL Sbjct: 120 NRFYEPPWAEALLGSSCPWSAHQDHWSQRKDCRCL 154