BLASTX nr result
ID: Papaver31_contig00030934
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00030934 (1040 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010251683.1| PREDICTED: UBP1-associated protein 2A [Nelum... 79 5e-12 ref|XP_010943670.1| PREDICTED: UBP1-associated protein 2A-like [... 62 8e-07 >ref|XP_010251683.1| PREDICTED: UBP1-associated protein 2A [Nelumbo nucifera] gi|719986387|ref|XP_010251684.1| PREDICTED: UBP1-associated protein 2A [Nelumbo nucifera] gi|719986391|ref|XP_010251685.1| PREDICTED: UBP1-associated protein 2A [Nelumbo nucifera] Length = 508 Score = 79.3 bits (194), Expect = 5e-12 Identities = 38/43 (88%), Positives = 38/43 (88%), Gaps = 2/43 (4%) Frame = -1 Query: 1040 MAGYGTQPGMQGGYQNP-MGQPNAGRSQQG-GHMGGVPPYMGH 918 MAGYG QPGMQGGY NP MGQPNAGRSQQG GHMGGV PYMGH Sbjct: 466 MAGYGNQPGMQGGYPNPQMGQPNAGRSQQGVGHMGGVAPYMGH 508 >ref|XP_010943670.1| PREDICTED: UBP1-associated protein 2A-like [Elaeis guineensis] gi|743862930|ref|XP_010943671.1| PREDICTED: UBP1-associated protein 2A-like [Elaeis guineensis] Length = 511 Score = 62.0 bits (149), Expect = 8e-07 Identities = 31/43 (72%), Positives = 32/43 (74%), Gaps = 2/43 (4%) Frame = -1 Query: 1040 MAGYGTQPGMQGGYQN-PMGQPNAGRSQQG-GHMGGVPPYMGH 918 M GYG Q GMQGGY N MGQ AGR+QQG GHMGGV PY GH Sbjct: 469 MGGYGAQAGMQGGYGNAQMGQGGAGRNQQGLGHMGGVTPYKGH 511