BLASTX nr result
ID: Papaver31_contig00030288
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00030288 (1758 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010263252.1| PREDICTED: F-box protein At5g07610-like [Nel... 64 3e-07 >ref|XP_010263252.1| PREDICTED: F-box protein At5g07610-like [Nelumbo nucifera] Length = 306 Score = 64.3 bits (155), Expect = 3e-07 Identities = 32/52 (61%), Positives = 37/52 (71%) Frame = -3 Query: 1753 NNTDLLLQILLYAPVKSLFIFKSESKQWLSLISDSQFIQNRCIHNPPKVSGL 1598 N+ DLL +ILL PVKSL FKS SKQWLS IS+ +F N C+ NP VSGL Sbjct: 28 NSNDLLSEILLRLPVKSLVRFKSVSKQWLSQISNPRFTHNHCLRNPSSVSGL 79