BLASTX nr result
ID: Papaver31_contig00029214
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00029214 (490 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007016585.1| Chitinase 1 [Theobroma cacao] gi|508786948|g... 56 9e-06 >ref|XP_007016585.1| Chitinase 1 [Theobroma cacao] gi|508786948|gb|EOY34204.1| Chitinase 1 [Theobroma cacao] Length = 321 Score = 56.2 bits (134), Expect = 9e-06 Identities = 29/48 (60%), Positives = 34/48 (70%) Frame = +2 Query: 170 NGIFTACSKLGSQGKLHRIYIWLADDSKK*WFLL*KTISSQAILAGSH 313 NG FTACS+L SQ KLH I++W ADDSK+ F K SQA+LA SH Sbjct: 276 NGFFTACSRLKSQNKLHGIFVWSADDSKRNGFRYEK--QSQALLASSH 321