BLASTX nr result
ID: Papaver31_contig00029174
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00029174 (740 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010257230.1| PREDICTED: armadillo repeat-containing prote... 57 1e-05 >ref|XP_010257230.1| PREDICTED: armadillo repeat-containing protein 8-like [Nelumbo nucifera] Length = 649 Score = 57.4 bits (137), Expect = 1e-05 Identities = 28/52 (53%), Positives = 37/52 (71%) Frame = -1 Query: 740 IGSIFTLSNVADGNELHKEAMMRHLLQYESSECSQGAIVKFLQGNDSQL*TA 585 I ++ LSNVA GNELHKEA+M L Q ++ E +Q ++KFLQ +D QL TA Sbjct: 541 IQGMYVLSNVASGNELHKEAVMNQLFQSQAGEGTQSFVMKFLQDSDGQLRTA 592