BLASTX nr result
ID: Papaver31_contig00029091
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00029091 (777 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006858410.1| PREDICTED: protein transport protein Sec24-l... 66 3e-08 ref|XP_010246048.1| PREDICTED: protein transport protein Sec24-l... 65 4e-08 ref|XP_010274889.1| PREDICTED: protein transport protein Sec24-l... 62 4e-07 gb|KMZ58900.1| Protein transport protein Sec24-like protein [Zos... 52 1e-06 >ref|XP_006858410.1| PREDICTED: protein transport protein Sec24-like At3g07100 [Amborella trichopoda] gi|548862519|gb|ERN19877.1| hypothetical protein AMTR_s00071p00045940 [Amborella trichopoda] Length = 1080 Score = 65.9 bits (159), Expect = 3e-08 Identities = 31/52 (59%), Positives = 37/52 (71%) Frame = -1 Query: 747 PISGELRSKWPLYIYDDGFRFVIWFGSRLSSDLVTKLVGVDFSTLTDLSKVR 592 P+S E LYIYDDGFRFVIWFG LS+D+V KL+G + S DLSKV+ Sbjct: 954 PLSAESLDPSGLYIYDDGFRFVIWFGKVLSADIVNKLLGPEISAFADLSKVK 1005 >ref|XP_010246048.1| PREDICTED: protein transport protein Sec24-like At3g07100 [Nelumbo nucifera] Length = 998 Score = 65.5 bits (158), Expect = 4e-08 Identities = 30/56 (53%), Positives = 37/56 (66%) Frame = -1 Query: 762 FQNVAPISGELRSKWPLYIYDDGFRFVIWFGSRLSSDLVTKLVGVDFSTLTDLSKV 595 F P++ + LYIYDDGFRF++WFG LSSD+ L+GVD ST DLSKV Sbjct: 867 FSKSLPLTMQSLDSRGLYIYDDGFRFIMWFGKMLSSDIAVNLLGVDLSTFPDLSKV 922 >ref|XP_010274889.1| PREDICTED: protein transport protein Sec24-like At3g07100 [Nelumbo nucifera] gi|720060491|ref|XP_010274890.1| PREDICTED: protein transport protein Sec24-like At3g07100 [Nelumbo nucifera] gi|720060494|ref|XP_010274891.1| PREDICTED: protein transport protein Sec24-like At3g07100 [Nelumbo nucifera] gi|720060497|ref|XP_010274894.1| PREDICTED: protein transport protein Sec24-like At3g07100 [Nelumbo nucifera] Length = 996 Score = 62.0 bits (149), Expect = 4e-07 Identities = 28/56 (50%), Positives = 36/56 (64%) Frame = -1 Query: 762 FQNVAPISGELRSKWPLYIYDDGFRFVIWFGSRLSSDLVTKLVGVDFSTLTDLSKV 595 F P++ + LYIYDDGFRF++WFG LSSD+ L+G+D ST D SKV Sbjct: 865 FSKSLPLAMQSLDSRGLYIYDDGFRFILWFGKMLSSDIAVNLLGMDLSTFPDPSKV 920 >gb|KMZ58900.1| Protein transport protein Sec24-like protein [Zostera marina] Length = 1027 Score = 52.4 bits (124), Expect(2) = 1e-06 Identities = 23/40 (57%), Positives = 33/40 (82%) Frame = -1 Query: 714 LYIYDDGFRFVIWFGSRLSSDLVTKLVGVDFSTLTDLSKV 595 LY++DDGFRFV+WFG+ LS+ ++T ++G D S + DLSKV Sbjct: 913 LYLFDDGFRFVVWFGTMLSAYVITSILG-DLSGIHDLSKV 951 Score = 28.1 bits (61), Expect(2) = 1e-06 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -2 Query: 767 NHFKMLPLSVESLDPSGLSIY 705 N K LPLS SLDP GL ++ Sbjct: 896 NFLKRLPLSTTSLDPKGLYLF 916