BLASTX nr result
ID: Papaver31_contig00028502
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00028502 (600 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010266270.1| PREDICTED: plant intracellular Ras-group-rel... 62 2e-07 ref|XP_008799248.1| PREDICTED: plant intracellular Ras-group-rel... 62 2e-07 ref|XP_008799240.1| PREDICTED: plant intracellular Ras-group-rel... 62 2e-07 ref|XP_008799232.1| PREDICTED: plant intracellular Ras-group-rel... 62 2e-07 emb|CDP01759.1| unnamed protein product [Coffea canephora] 59 2e-06 ref|XP_006849986.1| PREDICTED: plant intracellular Ras-group-rel... 59 2e-06 ref|XP_004512290.1| PREDICTED: plant intracellular Ras-group-rel... 57 7e-06 ref|XP_007046446.1| Plant intracellular ras group-related LRR 4 ... 57 1e-05 >ref|XP_010266270.1| PREDICTED: plant intracellular Ras-group-related LRR protein 4-like [Nelumbo nucifera] gi|720032941|ref|XP_010266271.1| PREDICTED: plant intracellular Ras-group-related LRR protein 4-like [Nelumbo nucifera] gi|720032944|ref|XP_010266272.1| PREDICTED: plant intracellular Ras-group-related LRR protein 4-like [Nelumbo nucifera] Length = 568 Score = 62.4 bits (150), Expect = 2e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 596 KKQPVKGKKTWAQCCFFSRPNKRKHDGMDYVK 501 K QP+K KK+WAQ CFFSRPNKRKHDG+DYVK Sbjct: 536 KVQPLKQKKSWAQFCFFSRPNKRKHDGLDYVK 567 >ref|XP_008799248.1| PREDICTED: plant intracellular Ras-group-related LRR protein 4 isoform X3 [Phoenix dactylifera] Length = 385 Score = 62.4 bits (150), Expect = 2e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 596 KKQPVKGKKTWAQCCFFSRPNKRKHDGMDYV 504 K QPVK KK+WAQ CFFSRPNKRKHDG+DY+ Sbjct: 354 KPQPVKSKKSWAQFCFFSRPNKRKHDGLDYI 384 >ref|XP_008799240.1| PREDICTED: plant intracellular Ras-group-related LRR protein 4 isoform X2 [Phoenix dactylifera] Length = 553 Score = 62.4 bits (150), Expect = 2e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 596 KKQPVKGKKTWAQCCFFSRPNKRKHDGMDYV 504 K QPVK KK+WAQ CFFSRPNKRKHDG+DY+ Sbjct: 522 KPQPVKSKKSWAQFCFFSRPNKRKHDGLDYI 552 >ref|XP_008799232.1| PREDICTED: plant intracellular Ras-group-related LRR protein 4 isoform X1 [Phoenix dactylifera] Length = 555 Score = 62.4 bits (150), Expect = 2e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 596 KKQPVKGKKTWAQCCFFSRPNKRKHDGMDYV 504 K QPVK KK+WAQ CFFSRPNKRKHDG+DY+ Sbjct: 524 KPQPVKSKKSWAQFCFFSRPNKRKHDGLDYI 554 >emb|CDP01759.1| unnamed protein product [Coffea canephora] Length = 586 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -2 Query: 599 AKKQPVKGKKTWAQCCFFSRPNKRKHDGMDYVK 501 AK QPVK KK+WAQ CFFSR NKRK +GMDYVK Sbjct: 553 AKPQPVKQKKSWAQICFFSRSNKRKRNGMDYVK 585 >ref|XP_006849986.1| PREDICTED: plant intracellular Ras-group-related LRR protein 4 [Amborella trichopoda] gi|769805173|ref|XP_011625429.1| PREDICTED: plant intracellular Ras-group-related LRR protein 4 [Amborella trichopoda] gi|548853584|gb|ERN11567.1| hypothetical protein AMTR_s00022p00162750 [Amborella trichopoda] Length = 560 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -2 Query: 599 AKKQPVKGKKTWAQCCFFSRPNKRKHDGMDYVK 501 +K Q VK KK+WAQ CFFSRPNKRKH GMDYVK Sbjct: 527 SKTQTVKQKKSWAQFCFFSRPNKRKHYGMDYVK 559 >ref|XP_004512290.1| PREDICTED: plant intracellular Ras-group-related LRR protein 4 [Cicer arietinum] Length = 580 Score = 57.0 bits (136), Expect = 7e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -2 Query: 599 AKKQPVKGKKTWAQCCFFSRPNKRKHDGMDYVK 501 AK QP K KK+WAQ CFFSR NKRK DG+DYVK Sbjct: 547 AKPQPPKQKKSWAQICFFSRSNKRKRDGVDYVK 579 >ref|XP_007046446.1| Plant intracellular ras group-related LRR 4 [Theobroma cacao] gi|508698707|gb|EOX90603.1| Plant intracellular ras group-related LRR 4 [Theobroma cacao] Length = 564 Score = 56.6 bits (135), Expect = 1e-05 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -2 Query: 596 KKQPVKGKKTWAQCCFFSRPNKRKHDGMDYVK 501 K QP+K KK+WAQ CFFSR NKRK +GMDYVK Sbjct: 532 KSQPMKQKKSWAQICFFSRSNKRKRNGMDYVK 563