BLASTX nr result
ID: Papaver31_contig00028148
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00028148 (532 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010934605.1| PREDICTED: 50S ribosomal protein L9, chlorop... 59 1e-06 ref|XP_010273624.1| PREDICTED: 50S ribosomal protein L9, chlorop... 59 2e-06 >ref|XP_010934605.1| PREDICTED: 50S ribosomal protein L9, chloroplastic [Elaeis guineensis] gi|743831168|ref|XP_010934606.1| PREDICTED: 50S ribosomal protein L9, chloroplastic [Elaeis guineensis] gi|743831172|ref|XP_010934607.1| PREDICTED: 50S ribosomal protein L9, chloroplastic [Elaeis guineensis] gi|743831176|ref|XP_010934608.1| PREDICTED: 50S ribosomal protein L9, chloroplastic [Elaeis guineensis] gi|743831180|ref|XP_010934609.1| PREDICTED: 50S ribosomal protein L9, chloroplastic [Elaeis guineensis] gi|743831184|ref|XP_010934610.1| PREDICTED: 50S ribosomal protein L9, chloroplastic [Elaeis guineensis] Length = 216 Score = 58.9 bits (141), Expect = 1e-06 Identities = 31/47 (65%), Positives = 36/47 (76%), Gaps = 2/47 (4%) Frame = -1 Query: 496 AHIRCGRIVLRGMIKPQRCSD--SITHPLLFAIQGLRYRKLEVILTT 362 AH+RCGR LR ++ Q S SIT+P+LFA QGLRYRKLEVILTT Sbjct: 2 AHVRCGRDALRRLVGAQTSSSTASITNPILFAGQGLRYRKLEVILTT 48 >ref|XP_010273624.1| PREDICTED: 50S ribosomal protein L9, chloroplastic [Nelumbo nucifera] gi|720056246|ref|XP_010273625.1| PREDICTED: 50S ribosomal protein L9, chloroplastic [Nelumbo nucifera] gi|720056250|ref|XP_010273626.1| PREDICTED: 50S ribosomal protein L9, chloroplastic [Nelumbo nucifera] gi|720056253|ref|XP_010273627.1| PREDICTED: 50S ribosomal protein L9, chloroplastic [Nelumbo nucifera] Length = 207 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/47 (61%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = -1 Query: 496 AHIRCGRIVLRGMIKPQRCS--DSITHPLLFAIQGLRYRKLEVILTT 362 AH +CGR +LR ++K + D ITHPLLF QGLRYRKLE+ILTT Sbjct: 2 AHFQCGRNILRQIVKDKSLHSFDIITHPLLFTSQGLRYRKLEIILTT 48