BLASTX nr result
ID: Papaver31_contig00027765
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00027765 (791 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KQL02646.1| hypothetical protein SETIT_013828mg [Setaria ital... 58 7e-06 gb|KJB19775.1| hypothetical protein B456_003G120600 [Gossypium r... 58 7e-06 gb|KJB19774.1| hypothetical protein B456_003G120600 [Gossypium r... 58 7e-06 gb|KJB19773.1| hypothetical protein B456_003G120600 [Gossypium r... 58 7e-06 ref|XP_012471137.1| PREDICTED: serine/threonine-protein kinase r... 58 7e-06 ref|XP_011074796.1| PREDICTED: LOW QUALITY PROTEIN: serine/threo... 58 7e-06 gb|KHG14586.1| Serine/threonine-protein kinase rio1 [Gossypium a... 58 7e-06 ref|XP_009603843.1| PREDICTED: serine/threonine-protein kinase R... 58 7e-06 emb|CDP11966.1| unnamed protein product [Coffea canephora] 58 7e-06 ref|XP_012079836.1| PREDICTED: serine/threonine-protein kinase r... 58 7e-06 gb|KDO52673.1| hypothetical protein CISIN_1g011300mg [Citrus sin... 58 7e-06 gb|KDO52672.1| hypothetical protein CISIN_1g011300mg [Citrus sin... 58 7e-06 gb|KDO52671.1| hypothetical protein CISIN_1g011300mg [Citrus sin... 58 7e-06 ref|XP_012853427.1| PREDICTED: serine/threonine-protein kinase r... 58 7e-06 ref|XP_006477034.1| PREDICTED: serine/threonine-protein kinase R... 58 7e-06 ref|XP_006440115.1| hypothetical protein CICLE_v10018838mg [Citr... 58 7e-06 ref|XP_004974000.1| PREDICTED: serine/threonine-protein kinase R... 58 7e-06 ref|XP_007037981.1| Serine/threonine-protein kinase Rio1 [Theobr... 58 7e-06 gb|EMT16982.1| Serine/threonine-protein kinase rio1 [Aegilops ta... 58 7e-06 gb|EMT10565.1| Serine/threonine-protein kinase rio1 [Aegilops ta... 58 7e-06 >gb|KQL02646.1| hypothetical protein SETIT_013828mg [Setaria italica] Length = 415 Score = 58.2 bits (139), Expect = 7e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 786 DIDRFG*GDYRFRLGYCKHNPRKMVRTWTEK 694 D DR+ GDYRFR GYCKHNPRKMV+TW EK Sbjct: 52 DRDRYVQGDYRFRYGYCKHNPRKMVKTWAEK 82 >gb|KJB19775.1| hypothetical protein B456_003G120600 [Gossypium raimondii] Length = 382 Score = 58.2 bits (139), Expect = 7e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 786 DIDRFG*GDYRFRLGYCKHNPRKMVRTWTEK 694 D DR+ GDYRFR GYCKHNPRKMV+TW EK Sbjct: 21 DRDRYVQGDYRFRYGYCKHNPRKMVKTWAEK 51 >gb|KJB19774.1| hypothetical protein B456_003G120600 [Gossypium raimondii] Length = 430 Score = 58.2 bits (139), Expect = 7e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 786 DIDRFG*GDYRFRLGYCKHNPRKMVRTWTEK 694 D DR+ GDYRFR GYCKHNPRKMV+TW EK Sbjct: 69 DRDRYVQGDYRFRYGYCKHNPRKMVKTWAEK 99 >gb|KJB19773.1| hypothetical protein B456_003G120600 [Gossypium raimondii] Length = 405 Score = 58.2 bits (139), Expect = 7e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 786 DIDRFG*GDYRFRLGYCKHNPRKMVRTWTEK 694 D DR+ GDYRFR GYCKHNPRKMV+TW EK Sbjct: 197 DRDRYVQGDYRFRYGYCKHNPRKMVKTWAEK 227 >ref|XP_012471137.1| PREDICTED: serine/threonine-protein kinase rio1-like [Gossypium raimondii] gi|763752384|gb|KJB19772.1| hypothetical protein B456_003G120600 [Gossypium raimondii] Length = 558 Score = 58.2 bits (139), Expect = 7e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 786 DIDRFG*GDYRFRLGYCKHNPRKMVRTWTEK 694 D DR+ GDYRFR GYCKHNPRKMV+TW EK Sbjct: 197 DRDRYVQGDYRFRYGYCKHNPRKMVKTWAEK 227 >ref|XP_011074796.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein kinase RIO1-like [Sesamum indicum] Length = 572 Score = 58.2 bits (139), Expect = 7e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 786 DIDRFG*GDYRFRLGYCKHNPRKMVRTWTEK 694 D DR+ GDYRFR GYCKHNPRKMV+TW EK Sbjct: 209 DRDRYVQGDYRFRYGYCKHNPRKMVKTWAEK 239 >gb|KHG14586.1| Serine/threonine-protein kinase rio1 [Gossypium arboreum] gi|728845268|gb|KHG24711.1| Serine/threonine-protein kinase rio1 [Gossypium arboreum] Length = 562 Score = 58.2 bits (139), Expect = 7e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 786 DIDRFG*GDYRFRLGYCKHNPRKMVRTWTEK 694 D DR+ GDYRFR GYCKHNPRKMV+TW EK Sbjct: 201 DRDRYVQGDYRFRYGYCKHNPRKMVKTWAEK 231 >ref|XP_009603843.1| PREDICTED: serine/threonine-protein kinase RIO1-like [Nicotiana tomentosiformis] Length = 563 Score = 58.2 bits (139), Expect = 7e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 786 DIDRFG*GDYRFRLGYCKHNPRKMVRTWTEK 694 D DR+ GDYRFR GYCKHNPRKMV+TW EK Sbjct: 211 DRDRYVQGDYRFRYGYCKHNPRKMVKTWAEK 241 >emb|CDP11966.1| unnamed protein product [Coffea canephora] Length = 553 Score = 58.2 bits (139), Expect = 7e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 786 DIDRFG*GDYRFRLGYCKHNPRKMVRTWTEK 694 D DR+ GDYRFR GYCKHNPRKMV+TW EK Sbjct: 196 DRDRYVQGDYRFRYGYCKHNPRKMVKTWAEK 226 >ref|XP_012079836.1| PREDICTED: serine/threonine-protein kinase rio1-like [Jatropha curcas] gi|643720653|gb|KDP30917.1| hypothetical protein JCGZ_11293 [Jatropha curcas] Length = 560 Score = 58.2 bits (139), Expect = 7e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 786 DIDRFG*GDYRFRLGYCKHNPRKMVRTWTEK 694 D DR+ GDYRFR GYCKHNPRKMV+TW EK Sbjct: 203 DRDRYVQGDYRFRYGYCKHNPRKMVKTWAEK 233 >gb|KDO52673.1| hypothetical protein CISIN_1g011300mg [Citrus sinensis] Length = 328 Score = 58.2 bits (139), Expect = 7e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 786 DIDRFG*GDYRFRLGYCKHNPRKMVRTWTEK 694 D DR+ GDYRFR GYCKHNPRKMV+TW EK Sbjct: 144 DRDRYVQGDYRFRYGYCKHNPRKMVKTWAEK 174 >gb|KDO52672.1| hypothetical protein CISIN_1g011300mg [Citrus sinensis] Length = 397 Score = 58.2 bits (139), Expect = 7e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 786 DIDRFG*GDYRFRLGYCKHNPRKMVRTWTEK 694 D DR+ GDYRFR GYCKHNPRKMV+TW EK Sbjct: 52 DRDRYVQGDYRFRYGYCKHNPRKMVKTWAEK 82 >gb|KDO52671.1| hypothetical protein CISIN_1g011300mg [Citrus sinensis] Length = 489 Score = 58.2 bits (139), Expect = 7e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 786 DIDRFG*GDYRFRLGYCKHNPRKMVRTWTEK 694 D DR+ GDYRFR GYCKHNPRKMV+TW EK Sbjct: 144 DRDRYVQGDYRFRYGYCKHNPRKMVKTWAEK 174 >ref|XP_012853427.1| PREDICTED: serine/threonine-protein kinase rio1-like [Erythranthe guttatus] gi|604304601|gb|EYU23852.1| hypothetical protein MIMGU_mgv1a004030mg [Erythranthe guttata] gi|604304602|gb|EYU23853.1| hypothetical protein MIMGU_mgv1a004030mg [Erythranthe guttata] Length = 548 Score = 58.2 bits (139), Expect = 7e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 786 DIDRFG*GDYRFRLGYCKHNPRKMVRTWTEK 694 D DR+ GDYRFR GYCKHNPRKMV+TW EK Sbjct: 208 DRDRYVQGDYRFRYGYCKHNPRKMVKTWAEK 238 >ref|XP_006477034.1| PREDICTED: serine/threonine-protein kinase RIO1-like isoform X1 [Citrus sinensis] gi|568846383|ref|XP_006477035.1| PREDICTED: serine/threonine-protein kinase RIO1-like isoform X2 [Citrus sinensis] Length = 550 Score = 58.2 bits (139), Expect = 7e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 786 DIDRFG*GDYRFRLGYCKHNPRKMVRTWTEK 694 D DR+ GDYRFR GYCKHNPRKMV+TW EK Sbjct: 205 DRDRYVQGDYRFRYGYCKHNPRKMVKTWAEK 235 >ref|XP_006440115.1| hypothetical protein CICLE_v10018838mg [Citrus clementina] gi|557542377|gb|ESR53355.1| hypothetical protein CICLE_v10018838mg [Citrus clementina] Length = 845 Score = 58.2 bits (139), Expect = 7e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 786 DIDRFG*GDYRFRLGYCKHNPRKMVRTWTEK 694 D DR+ GDYRFR GYCKHNPRKMV+TW EK Sbjct: 205 DRDRYVQGDYRFRYGYCKHNPRKMVKTWAEK 235 >ref|XP_004974000.1| PREDICTED: serine/threonine-protein kinase RIO1-like [Setaria italica] Length = 576 Score = 58.2 bits (139), Expect = 7e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 786 DIDRFG*GDYRFRLGYCKHNPRKMVRTWTEK 694 D DR+ GDYRFR GYCKHNPRKMV+TW EK Sbjct: 213 DRDRYVQGDYRFRYGYCKHNPRKMVKTWAEK 243 >ref|XP_007037981.1| Serine/threonine-protein kinase Rio1 [Theobroma cacao] gi|508775226|gb|EOY22482.1| Serine/threonine-protein kinase Rio1 [Theobroma cacao] Length = 620 Score = 58.2 bits (139), Expect = 7e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 786 DIDRFG*GDYRFRLGYCKHNPRKMVRTWTEK 694 D DR+ GDYRFR GYCKHNPRKMV+TW EK Sbjct: 257 DRDRYVQGDYRFRYGYCKHNPRKMVKTWAEK 287 >gb|EMT16982.1| Serine/threonine-protein kinase rio1 [Aegilops tauschii] Length = 577 Score = 58.2 bits (139), Expect = 7e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 786 DIDRFG*GDYRFRLGYCKHNPRKMVRTWTEK 694 D DR+ GDYRFR GYCKHNPRKMV+TW EK Sbjct: 251 DRDRYVQGDYRFRYGYCKHNPRKMVKTWAEK 281 >gb|EMT10565.1| Serine/threonine-protein kinase rio1 [Aegilops tauschii] Length = 334 Score = 58.2 bits (139), Expect = 7e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 786 DIDRFG*GDYRFRLGYCKHNPRKMVRTWTEK 694 D DR+ GDYRFR GYCKHNPRKMV+TW EK Sbjct: 230 DRDRYVQGDYRFRYGYCKHNPRKMVKTWAEK 260