BLASTX nr result
ID: Papaver31_contig00027681
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00027681 (782 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB18362.1| hypothetical protein B456_003G048700 [Gossypium r... 62 6e-07 >gb|KJB18362.1| hypothetical protein B456_003G048700 [Gossypium raimondii] Length = 86 Score = 61.6 bits (148), Expect = 6e-07 Identities = 31/40 (77%), Positives = 34/40 (85%), Gaps = 2/40 (5%) Frame = -1 Query: 440 MMINLRLVSQEHL--PPKSFRLSPGLRANAALFLPWMSET 327 MMIN RLVSQ+H PP+SFRLSPGLRA+A L LPWMSET Sbjct: 1 MMINQRLVSQKHSQWPPESFRLSPGLRASAVLLLPWMSET 40