BLASTX nr result
ID: Papaver31_contig00027383
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00027383 (626 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KMZ61758.1| putative ubiquitin-conjugating enzyme E2 16 [Zost... 76 2e-11 ref|XP_010110015.1| putative ubiquitin-conjugating enzyme E2 16 ... 76 2e-11 ref|XP_012466288.1| PREDICTED: probable ubiquitin-conjugating en... 76 2e-11 ref|XP_012466300.1| PREDICTED: probable ubiquitin-conjugating en... 76 2e-11 ref|XP_012466295.1| PREDICTED: probable ubiquitin-conjugating en... 76 2e-11 ref|XP_012466307.1| PREDICTED: probable ubiquitin-conjugating en... 76 2e-11 ref|XP_010932730.1| PREDICTED: probable ubiquitin-conjugating en... 76 2e-11 ref|XP_010275535.1| PREDICTED: probable ubiquitin-conjugating en... 76 2e-11 ref|XP_010254687.1| PREDICTED: probable ubiquitin-conjugating en... 76 2e-11 ref|XP_009417125.1| PREDICTED: probable ubiquitin-conjugating en... 76 2e-11 ref|XP_009335788.1| PREDICTED: probable ubiquitin-conjugating en... 76 2e-11 ref|XP_008796602.1| PREDICTED: probable ubiquitin-conjugating en... 76 2e-11 ref|XP_008796601.1| PREDICTED: probable ubiquitin-conjugating en... 76 2e-11 ref|XP_008794009.1| PREDICTED: probable ubiquitin-conjugating en... 76 2e-11 emb|CDP07466.1| unnamed protein product [Coffea canephora] 76 2e-11 ref|XP_008221345.1| PREDICTED: probable ubiquitin-conjugating en... 76 2e-11 ref|XP_006435068.1| hypothetical protein CICLE_v10002737mg [Citr... 76 2e-11 ref|XP_007017643.1| Ubiquitin-conjugating enzyme family protein ... 76 2e-11 ref|XP_007017642.1| Ubiquitin-conjugating enzyme family protein ... 76 2e-11 ref|XP_007017641.1| Ubiquitin-conjugating enzyme family protein ... 76 2e-11 >gb|KMZ61758.1| putative ubiquitin-conjugating enzyme E2 16 [Zostera marina] Length = 161 Score = 75.9 bits (185), Expect = 2e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 624 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 532 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV Sbjct: 131 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 161 >ref|XP_010110015.1| putative ubiquitin-conjugating enzyme E2 16 [Morus notabilis] gi|587938284|gb|EXC25033.1| putative ubiquitin-conjugating enzyme E2 16 [Morus notabilis] Length = 161 Score = 75.9 bits (185), Expect = 2e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 624 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 532 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV Sbjct: 131 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 161 >ref|XP_012466288.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 18 isoform X1 [Gossypium raimondii] Length = 200 Score = 75.9 bits (185), Expect = 2e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 624 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 532 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV Sbjct: 170 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 200 >ref|XP_012466300.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 18 isoform X3 [Gossypium raimondii] gi|763747032|gb|KJB14471.1| hypothetical protein B456_002G126400 [Gossypium raimondii] Length = 179 Score = 75.9 bits (185), Expect = 2e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 624 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 532 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV Sbjct: 149 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 179 >ref|XP_012466295.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 18 isoform X2 [Gossypium raimondii] gi|763747031|gb|KJB14470.1| hypothetical protein B456_002G126400 [Gossypium raimondii] Length = 182 Score = 75.9 bits (185), Expect = 2e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 624 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 532 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV Sbjct: 152 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 182 >ref|XP_012466307.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 18 isoform X4 [Gossypium raimondii] gi|763747030|gb|KJB14469.1| hypothetical protein B456_002G126400 [Gossypium raimondii] Length = 161 Score = 75.9 bits (185), Expect = 2e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 624 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 532 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV Sbjct: 131 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 161 >ref|XP_010932730.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 16 [Elaeis guineensis] Length = 161 Score = 75.9 bits (185), Expect = 2e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 624 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 532 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV Sbjct: 131 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 161 >ref|XP_010275535.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 16 [Nelumbo nucifera] Length = 161 Score = 75.9 bits (185), Expect = 2e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 624 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 532 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV Sbjct: 131 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 161 >ref|XP_010254687.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 16 [Nelumbo nucifera] Length = 161 Score = 75.9 bits (185), Expect = 2e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 624 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 532 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV Sbjct: 131 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 161 >ref|XP_009417125.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 16 [Musa acuminata subsp. malaccensis] Length = 161 Score = 75.9 bits (185), Expect = 2e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 624 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 532 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV Sbjct: 131 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 161 >ref|XP_009335788.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 18 [Pyrus x bretschneideri] Length = 161 Score = 75.9 bits (185), Expect = 2e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 624 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 532 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV Sbjct: 131 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 161 >ref|XP_008796602.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 16 isoform X2 [Phoenix dactylifera] Length = 193 Score = 75.9 bits (185), Expect = 2e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 624 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 532 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV Sbjct: 163 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 193 >ref|XP_008796601.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 16 isoform X1 [Phoenix dactylifera] Length = 211 Score = 75.9 bits (185), Expect = 2e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 624 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 532 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV Sbjct: 181 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 211 >ref|XP_008794009.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 16 [Phoenix dactylifera] Length = 161 Score = 75.9 bits (185), Expect = 2e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 624 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 532 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV Sbjct: 131 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 161 >emb|CDP07466.1| unnamed protein product [Coffea canephora] Length = 161 Score = 75.9 bits (185), Expect = 2e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 624 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 532 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV Sbjct: 131 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 161 >ref|XP_008221345.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 18 [Prunus mume] Length = 161 Score = 75.9 bits (185), Expect = 2e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 624 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 532 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV Sbjct: 131 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 161 >ref|XP_006435068.1| hypothetical protein CICLE_v10002737mg [Citrus clementina] gi|568839174|ref|XP_006473566.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 16-like [Citrus sinensis] gi|557537190|gb|ESR48308.1| hypothetical protein CICLE_v10002737mg [Citrus clementina] gi|641865985|gb|KDO84670.1| hypothetical protein CISIN_1g031319mg [Citrus sinensis] Length = 161 Score = 75.9 bits (185), Expect = 2e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 624 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 532 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV Sbjct: 131 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 161 >ref|XP_007017643.1| Ubiquitin-conjugating enzyme family protein isoform 3 [Theobroma cacao] gi|508722971|gb|EOY14868.1| Ubiquitin-conjugating enzyme family protein isoform 3 [Theobroma cacao] Length = 162 Score = 75.9 bits (185), Expect = 2e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 624 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 532 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV Sbjct: 132 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 162 >ref|XP_007017642.1| Ubiquitin-conjugating enzyme family protein isoform 2 [Theobroma cacao] gi|508722970|gb|EOY14867.1| Ubiquitin-conjugating enzyme family protein isoform 2 [Theobroma cacao] Length = 167 Score = 75.9 bits (185), Expect = 2e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 624 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 532 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV Sbjct: 137 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 167 >ref|XP_007017641.1| Ubiquitin-conjugating enzyme family protein isoform 1 [Theobroma cacao] gi|508722969|gb|EOY14866.1| Ubiquitin-conjugating enzyme family protein isoform 1 [Theobroma cacao] Length = 161 Score = 75.9 bits (185), Expect = 2e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 624 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 532 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV Sbjct: 131 QRPADNDRYVKNCRNGRSPKETRWWFHDDKV 161