BLASTX nr result
ID: Papaver31_contig00026629
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00026629 (707 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010274495.1| PREDICTED: uncharacterized protein LOC104609... 59 2e-06 emb|CDP19846.1| unnamed protein product [Coffea canephora] 58 7e-06 >ref|XP_010274495.1| PREDICTED: uncharacterized protein LOC104609811 [Nelumbo nucifera] Length = 529 Score = 59.3 bits (142), Expect = 2e-06 Identities = 31/46 (67%), Positives = 34/46 (73%) Frame = -1 Query: 707 PSANRTASYLYLQNLEAAEKPKLLESSNGTEAPASEKLNLESIPGL 570 PS+NR ASY YLQ + +KPKL ES GTE ASEK NLESIPGL Sbjct: 485 PSSNRNASYSYLQTFDVIKKPKLQES-RGTETSASEKYNLESIPGL 529 >emb|CDP19846.1| unnamed protein product [Coffea canephora] Length = 535 Score = 57.8 bits (138), Expect = 7e-06 Identities = 31/51 (60%), Positives = 37/51 (72%), Gaps = 5/51 (9%) Frame = -1 Query: 707 PSANRTASYLYLQNLEAAEKPKLL-----ESSNGTEAPASEKLNLESIPGL 570 PS+NR+ASY YLQ+L+A KPK+L E+S T ASEK NLESIPGL Sbjct: 485 PSSNRSASYNYLQSLDAMNKPKVLENHEAETSTSTSLAASEKYNLESIPGL 535