BLASTX nr result
ID: Papaver31_contig00026487
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00026487 (512 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515051.1| conserved hypothetical protein [Ricinus comm... 58 3e-06 >ref|XP_002515051.1| conserved hypothetical protein [Ricinus communis] gi|223546102|gb|EEF47605.1| conserved hypothetical protein [Ricinus communis] Length = 701 Score = 57.8 bits (138), Expect = 3e-06 Identities = 46/130 (35%), Positives = 63/130 (48%), Gaps = 13/130 (10%) Frame = +3 Query: 162 PHDSLPRV-----------GVMTDIIATDLPENITINVRSLLCIVKDILKYAISPSDLEE 308 PH S PR +M I AT P+ +VR LL +V+D+ + A+ PS L Sbjct: 5 PHRSNPRGERHMFSTSDDNAMMKQIQATHAPDGREFDVRPLLNVVEDVFQRAVPPSGLAT 64 Query: 309 --QPEFDLLRGMNNNPRLLKLLAHDILRIRTEILCYTESGDPWEEQEVAKRIFITVSRYS 482 QP+ L+ N +L LL++ I +I EI C G +A IF VS YS Sbjct: 65 IVQPQEKTLQ--NGFYEMLDLLSYTINKISCEIACKCSGGGDAHATTLA--IFNLVSSYS 120 Query: 483 WEVKLVVVLA 512 W+ KLV+ LA Sbjct: 121 WDAKLVLALA 130