BLASTX nr result
ID: Papaver31_contig00025740
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00025740 (1739 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AKJ83560.1| hypothetical protein ycf68 (chloroplast) [Alocasi... 62 2e-06 gb|AKJ83559.1| hypothetical protein ycf68 (chloroplast) [Alocasi... 61 3e-06 >gb|AKJ83560.1| hypothetical protein ycf68 (chloroplast) [Alocasia macrorrhizos] Length = 106 Score = 62.0 bits (149), Expect = 2e-06 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 210 GNSLLENPYTPYQCMYSYLSSTCLGSASVGKWSIADK 320 G+SLLENPYTPYQCM SYLSST GSAS+GKWS + + Sbjct: 39 GSSLLENPYTPYQCMDSYLSSTGSGSASMGKWSTSQR 75 >gb|AKJ83559.1| hypothetical protein ycf68 (chloroplast) [Alocasia macrorrhizos] Length = 106 Score = 61.2 bits (147), Expect = 3e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 210 GNSLLENPYTPYQCMYSYLSSTCLGSASVGKWS 308 G+SLLENPYTPYQCM SYLSST GSAS+GKWS Sbjct: 39 GSSLLENPYTPYQCMDSYLSSTGSGSASMGKWS 71