BLASTX nr result
ID: Papaver31_contig00025700
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00025700 (487 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAK06331.1| predicted protein [Hordeum vulgare subsp. vulgare] 57 5e-06 gb|KOM30099.1| hypothetical protein LR48_Vigan879s000300 [Vigna ... 57 7e-06 gb|KGN56323.1| hypothetical protein Csa_3G115610 [Cucumis sativus] 57 7e-06 ref|XP_002531993.1| cytochrome-c oxidase, putative [Ricinus comm... 57 7e-06 ref|XP_011650608.1| PREDICTED: cytochrome c oxidase subunit 6a, ... 57 7e-06 ref|XP_006357740.1| PREDICTED: cytochrome c oxidase subunit 6a, ... 56 9e-06 ref|XP_004231959.1| PREDICTED: cytochrome c oxidase subunit 6a, ... 56 9e-06 >dbj|BAK06331.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 76 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -3 Query: 485 LSKGHPHGEEQPAYPYMRIRNKEFPWSYSWWP 390 LSKGHPH +E PAYPY+RIRNKEFPW + P Sbjct: 14 LSKGHPHYDEPPAYPYLRIRNKEFPWGMNLLP 45 >gb|KOM30099.1| hypothetical protein LR48_Vigan879s000300 [Vigna angularis] Length = 117 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -3 Query: 485 LSKGHPHGEEQPAYPYMRIRNKEFPWSYS 399 LSKGHPH EE PAYPY+ IRNKEFPW S Sbjct: 63 LSKGHPHTEEPPAYPYLHIRNKEFPWGMS 91 >gb|KGN56323.1| hypothetical protein Csa_3G115610 [Cucumis sativus] Length = 96 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/26 (88%), Positives = 23/26 (88%) Frame = -3 Query: 485 LSKGHPHGEEQPAYPYMRIRNKEFPW 408 LSKGHPH EE PAYPYM IRNKEFPW Sbjct: 60 LSKGHPHHEEPPAYPYMHIRNKEFPW 85 >ref|XP_002531993.1| cytochrome-c oxidase, putative [Ricinus communis] gi|223528352|gb|EEF30392.1| cytochrome-c oxidase, putative [Ricinus communis] Length = 101 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/26 (88%), Positives = 23/26 (88%) Frame = -3 Query: 485 LSKGHPHGEEQPAYPYMRIRNKEFPW 408 LSKGHPH EE PAYPYM IRNKEFPW Sbjct: 65 LSKGHPHHEEPPAYPYMHIRNKEFPW 90 >ref|XP_011650608.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial isoform X2 [Cucumis sativus] Length = 98 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/26 (88%), Positives = 23/26 (88%) Frame = -3 Query: 485 LSKGHPHGEEQPAYPYMRIRNKEFPW 408 LSKGHPH EE PAYPYM IRNKEFPW Sbjct: 62 LSKGHPHHEEPPAYPYMHIRNKEFPW 87 >ref|XP_006357740.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial-like [Solanum tuberosum] Length = 100 Score = 56.2 bits (134), Expect = 9e-06 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = -3 Query: 485 LSKGHPHGEEQPAYPYMRIRNKEFPW 408 LSKGHPH EE PAYPY+ IRNKEFPW Sbjct: 64 LSKGHPHSEEPPAYPYLHIRNKEFPW 89 >ref|XP_004231959.1| PREDICTED: cytochrome c oxidase subunit 6a, mitochondrial [Solanum lycopersicum] Length = 100 Score = 56.2 bits (134), Expect = 9e-06 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = -3 Query: 485 LSKGHPHGEEQPAYPYMRIRNKEFPW 408 LSKGHPH EE PAYPY+ IRNKEFPW Sbjct: 64 LSKGHPHSEEPPAYPYLHIRNKEFPW 89