BLASTX nr result
ID: Papaver31_contig00025152
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00025152 (979 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJV66868.1| hypothetical protein APHNP_0132 [Anaplasma phagoc... 60 3e-06 ref|XP_012989788.1| PREDICTED: G-protein coupled receptor 64-lik... 59 4e-06 >gb|KJV66868.1| hypothetical protein APHNP_0132 [Anaplasma phagocytophilum str. ApNP] Length = 201 Score = 60.1 bits (144), Expect = 3e-06 Identities = 34/76 (44%), Positives = 50/76 (65%) Frame = +1 Query: 151 QLMVLSHR*PAIASQPSMIGH*RTAIASQLSMTSHRRTAIALKPSVTSHRKTAMALQLSM 330 Q +SH+ AI+ QPS I H +AI+ Q S SH+ +AI+ +PS SH+ +A++ Q S Sbjct: 90 QPSAISHQPSAISHQPSAISHQPSAISHQPSAISHQPSAISHQPSAISHQPSAISHQPSA 149 Query: 331 TSHRKTAIASQLSMIS 378 SH+ +AI+ QLSM S Sbjct: 150 ISHQPSAISHQLSMCS 165 >ref|XP_012989788.1| PREDICTED: G-protein coupled receptor 64-like isoform X1 [Esox lucius] gi|884953948|ref|XP_012989789.1| PREDICTED: G-protein coupled receptor 64-like isoform X1 [Esox lucius] gi|884953950|ref|XP_012989790.1| PREDICTED: G-protein coupled receptor 64-like isoform X1 [Esox lucius] gi|884953952|ref|XP_012989791.1| PREDICTED: G-protein coupled receptor 64-like isoform X1 [Esox lucius] Length = 1164 Score = 59.3 bits (142), Expect = 4e-06 Identities = 31/75 (41%), Positives = 41/75 (54%) Frame = +3 Query: 165 QPSMTSHSLTTIDDRPLKNSHSLTTIDD*PSKNSHSLKAIGDQPSKNSHGLTTIDDQPSK 344 QP+ TS +L T +P NS +L T P+ NS +L QP+ NS L T QP+ Sbjct: 397 QPNTTSTALNTTTSQPNNNSTALNTTTSQPNHNSTALNTTTSQPNTNSTALNTTTSQPNN 456 Query: 345 NSHSLTTIDDQPNAV 389 NS +L T QPNA+ Sbjct: 457 NSTALNTTTSQPNAI 471