BLASTX nr result
ID: Papaver31_contig00024554
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00024554 (584 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB46017.1| hypothetical protein B456_007G343500 [Gossypium r... 71 4e-10 ref|XP_012434716.1| PREDICTED: casein kinase I isoform delta-lik... 71 4e-10 gb|KHF98002.1| hypothetical protein F383_12939 [Gossypium arboreum] 71 4e-10 ref|XP_011021493.1| PREDICTED: uncharacterized protein LOC105123... 71 5e-10 ref|XP_010036218.1| PREDICTED: uncharacterized protein LOC104425... 71 5e-10 ref|XP_002325416.1| kinase family protein [Populus trichocarpa] ... 71 5e-10 ref|XP_007030718.1| Kinase family protein [Theobroma cacao] gi|5... 71 5e-10 ref|XP_004493152.1| PREDICTED: uncharacterized protein LOC101504... 70 6e-10 ref|XP_007161937.1| hypothetical protein PHAVU_001G110300g [Phas... 70 8e-10 ref|XP_003548750.1| PREDICTED: uncharacterized protein LOC100801... 70 8e-10 ref|XP_002960894.1| hypothetical protein SELMODRAFT_139482 [Sela... 70 8e-10 ref|XP_002967119.1| hypothetical protein SELMODRAFT_144765 [Sela... 70 8e-10 ref|XP_013612808.1| PREDICTED: uncharacterized protein LOC106319... 70 1e-09 ref|XP_009366444.1| PREDICTED: uncharacterized protein LOC103956... 70 1e-09 ref|XP_009121003.1| PREDICTED: uncharacterized protein LOC103845... 70 1e-09 emb|CDY25451.1| BnaC09g39660D [Brassica napus] 70 1e-09 ref|XP_012070457.1| PREDICTED: uncharacterized protein LOC105632... 70 1e-09 ref|XP_002525432.1| casein kinase, putative [Ricinus communis] g... 70 1e-09 ref|XP_012857309.1| PREDICTED: uncharacterized protein LOC105976... 70 1e-09 ref|XP_004288418.1| PREDICTED: uncharacterized protein LOC101290... 70 1e-09 >gb|KJB46017.1| hypothetical protein B456_007G343500 [Gossypium raimondii] Length = 739 Score = 71.2 bits (173), Expect = 4e-10 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 138 RRVSGGSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 19 RRVSGGSG +GP A+E+ LK +H+ SKGCNYGPPY WQVY Sbjct: 168 RRVSGGSGRTGPDAIEVALKLEHRNSKGCNYGPPYEWQVY 207 >ref|XP_012434716.1| PREDICTED: casein kinase I isoform delta-like [Gossypium raimondii] gi|763778893|gb|KJB46016.1| hypothetical protein B456_007G343500 [Gossypium raimondii] Length = 711 Score = 71.2 bits (173), Expect = 4e-10 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 138 RRVSGGSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 19 RRVSGGSG +GP A+E+ LK +H+ SKGCNYGPPY WQVY Sbjct: 168 RRVSGGSGRTGPDAIEVALKLEHRNSKGCNYGPPYEWQVY 207 >gb|KHF98002.1| hypothetical protein F383_12939 [Gossypium arboreum] Length = 668 Score = 71.2 bits (173), Expect = 4e-10 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 138 RRVSGGSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 19 RRVSGGSG +GP A+E+ LK +H+ SKGCNYGPPY WQVY Sbjct: 171 RRVSGGSGRTGPDAIEVALKLEHRNSKGCNYGPPYEWQVY 210 >ref|XP_011021493.1| PREDICTED: uncharacterized protein LOC105123555 [Populus euphratica] Length = 707 Score = 70.9 bits (172), Expect = 5e-10 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 138 RRVSGGSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 19 RRVSGGS +GP A+E+ LKF+H+ SKGCNYGPPY WQVY Sbjct: 161 RRVSGGSDRTGPDAIEVALKFEHRNSKGCNYGPPYEWQVY 200 >ref|XP_010036218.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis] gi|702492400|ref|XP_010036219.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis] gi|702492403|ref|XP_010036220.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis] gi|702492406|ref|XP_010036222.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis] gi|629081303|gb|KCW47748.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis] gi|629081304|gb|KCW47749.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis] gi|629081305|gb|KCW47750.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis] Length = 702 Score = 70.9 bits (172), Expect = 5e-10 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 138 RRVSGGSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 19 RRVSGGS +GP A+E+ LKF+H+ SKGCNYGPPY WQVY Sbjct: 159 RRVSGGSDRTGPDAIEVALKFEHRNSKGCNYGPPYEWQVY 198 >ref|XP_002325416.1| kinase family protein [Populus trichocarpa] gi|222862291|gb|EEE99797.1| kinase family protein [Populus trichocarpa] Length = 720 Score = 70.9 bits (172), Expect = 5e-10 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 138 RRVSGGSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 19 RRVSGGS +GP A+E+ LKF+H+ SKGCNYGPPY WQVY Sbjct: 161 RRVSGGSDRTGPDAIEVALKFEHRNSKGCNYGPPYEWQVY 200 >ref|XP_007030718.1| Kinase family protein [Theobroma cacao] gi|508719323|gb|EOY11220.1| Kinase family protein [Theobroma cacao] Length = 705 Score = 70.9 bits (172), Expect = 5e-10 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 138 RRVSGGSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 19 RRVSGGS +GP A+E+ LKF+H+ SKGCNYGPPY WQVY Sbjct: 162 RRVSGGSDRTGPDAIEVALKFEHRNSKGCNYGPPYEWQVY 201 >ref|XP_004493152.1| PREDICTED: uncharacterized protein LOC101504885 [Cicer arietinum] gi|502107088|ref|XP_004493153.1| PREDICTED: uncharacterized protein LOC101504885 [Cicer arietinum] Length = 708 Score = 70.5 bits (171), Expect = 6e-10 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 138 RRVSGGSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 19 RRVSGGS +GP A+E+ LKF+H+ SKGCNYGPPY WQVY Sbjct: 165 RRVSGGSERTGPDAIEVALKFEHRNSKGCNYGPPYEWQVY 204 >ref|XP_007161937.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris] gi|561035401|gb|ESW33931.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris] Length = 708 Score = 70.1 bits (170), Expect = 8e-10 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 138 RRVSGGSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 19 RR+SGGS +GP AVE+ LKF+H+ SKGCNYGPPY WQVY Sbjct: 165 RRLSGGSDRTGPDAVEVALKFEHRNSKGCNYGPPYEWQVY 204 >ref|XP_003548750.1| PREDICTED: uncharacterized protein LOC100801967 isoform X1 [Glycine max] gi|571525577|ref|XP_006598981.1| PREDICTED: uncharacterized protein LOC100801967 isoform X2 [Glycine max] gi|734433526|gb|KHN46781.1| Casein kinase I like hhp1 [Glycine soja] gi|947057310|gb|KRH06716.1| hypothetical protein GLYMA_16G041500 [Glycine max] Length = 709 Score = 70.1 bits (170), Expect = 8e-10 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 138 RRVSGGSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 19 RR+SGGS +GP AVE+ LKF+H+ SKGCNYGPPY WQVY Sbjct: 166 RRLSGGSDRTGPDAVEVALKFEHRNSKGCNYGPPYEWQVY 205 >ref|XP_002960894.1| hypothetical protein SELMODRAFT_139482 [Selaginella moellendorffii] gi|300171833|gb|EFJ38433.1| hypothetical protein SELMODRAFT_139482 [Selaginella moellendorffii] Length = 596 Score = 70.1 bits (170), Expect = 8e-10 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 138 RRVSGGSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 19 RR+SGGS +GP AVE+ LKF+H++SKGCNYGPPY WQVY Sbjct: 53 RRLSGGSERTGPQAVEVALKFEHRSSKGCNYGPPYEWQVY 92 >ref|XP_002967119.1| hypothetical protein SELMODRAFT_144765 [Selaginella moellendorffii] gi|300165110|gb|EFJ31718.1| hypothetical protein SELMODRAFT_144765 [Selaginella moellendorffii] Length = 596 Score = 70.1 bits (170), Expect = 8e-10 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 138 RRVSGGSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 19 RR+SGGS +GP AVE+ LKF+H++SKGCNYGPPY WQVY Sbjct: 53 RRLSGGSERTGPQAVEVALKFEHRSSKGCNYGPPYEWQVY 92 >ref|XP_013612808.1| PREDICTED: uncharacterized protein LOC106319114 [Brassica oleracea var. oleracea] gi|923801122|ref|XP_013687419.1| PREDICTED: uncharacterized protein LOC106391343 [Brassica napus] Length = 690 Score = 69.7 bits (169), Expect = 1e-09 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -3 Query: 138 RRVSGGSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 19 RRVSGGS GP AVE+ LKF+HK SKGCN+GPPY WQVY Sbjct: 147 RRVSGGSDRIGPDAVEVALKFEHKNSKGCNFGPPYEWQVY 186 >ref|XP_009366444.1| PREDICTED: uncharacterized protein LOC103956210 [Pyrus x bretschneideri] Length = 707 Score = 69.7 bits (169), Expect = 1e-09 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -3 Query: 138 RRVSGGSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 19 RRVSGG+ +GP A+E+ LKF+H+ SKGCNYGPPY WQVY Sbjct: 165 RRVSGGTDRTGPDAIEVALKFEHRNSKGCNYGPPYEWQVY 204 >ref|XP_009121003.1| PREDICTED: uncharacterized protein LOC103845859 [Brassica rapa] Length = 691 Score = 69.7 bits (169), Expect = 1e-09 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -3 Query: 138 RRVSGGSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 19 RRVSGGS GP AVE+ LKF+HK SKGCN+GPPY WQVY Sbjct: 148 RRVSGGSDRIGPDAVEVALKFEHKNSKGCNFGPPYEWQVY 187 >emb|CDY25451.1| BnaC09g39660D [Brassica napus] Length = 690 Score = 69.7 bits (169), Expect = 1e-09 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -3 Query: 138 RRVSGGSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 19 RRVSGGS GP AVE+ LKF+HK SKGCN+GPPY WQVY Sbjct: 147 RRVSGGSDRIGPDAVEVALKFEHKNSKGCNFGPPYEWQVY 186 >ref|XP_012070457.1| PREDICTED: uncharacterized protein LOC105632633 [Jatropha curcas] gi|643732610|gb|KDP39706.1| hypothetical protein JCGZ_02726 [Jatropha curcas] Length = 705 Score = 69.7 bits (169), Expect = 1e-09 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -3 Query: 138 RRVSGGSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 19 RRVSGG+ +GP A+E+ LKF+H+ SKGCNYGPPY WQVY Sbjct: 162 RRVSGGTDRTGPDAIEVALKFEHRNSKGCNYGPPYEWQVY 201 >ref|XP_002525432.1| casein kinase, putative [Ricinus communis] gi|223535245|gb|EEF36922.1| casein kinase, putative [Ricinus communis] Length = 705 Score = 69.7 bits (169), Expect = 1e-09 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -3 Query: 138 RRVSGGSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 19 RRVSGG+ +GP A+E+ LKF+H+ SKGCNYGPPY WQVY Sbjct: 162 RRVSGGTDRTGPDAIEVALKFEHRNSKGCNYGPPYEWQVY 201 >ref|XP_012857309.1| PREDICTED: uncharacterized protein LOC105976612 [Erythranthe guttatus] gi|604300944|gb|EYU20664.1| hypothetical protein MIMGU_mgv1a002165mg [Erythranthe guttata] Length = 706 Score = 69.7 bits (169), Expect = 1e-09 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = -3 Query: 138 RRVSGGSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 19 RRVSGG+G +GP A+E+ LK +H++SKGCNYGPPY WQVY Sbjct: 163 RRVSGGTGRTGPDAIEVALKCEHRSSKGCNYGPPYEWQVY 202 >ref|XP_004288418.1| PREDICTED: uncharacterized protein LOC101290807 [Fragaria vesca subsp. vesca] Length = 692 Score = 69.7 bits (169), Expect = 1e-09 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -3 Query: 138 RRVSGGSGTSGPTAVELVLKFKHKTSKGCNYGPPYWWQVY 19 RRVSGG+ +GP A+E+ LKF+H+ SKGCNYGPPY WQVY Sbjct: 149 RRVSGGTDRTGPDAIEVALKFEHRNSKGCNYGPPYEWQVY 188