BLASTX nr result
ID: Papaver31_contig00022194
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00022194 (734 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010259752.1| PREDICTED: exocyst complex component EXO84B-... 78 5e-12 emb|CBI25283.3| unnamed protein product [Vitis vinifera] 71 8e-10 ref|XP_002273667.1| PREDICTED: exocyst complex component EXO84B ... 71 8e-10 ref|XP_008462226.1| PREDICTED: exocyst complex component EXO84B ... 66 3e-08 ref|XP_004141739.1| PREDICTED: exocyst complex component EXO84B ... 66 3e-08 gb|KNA09615.1| hypothetical protein SOVF_152060 [Spinacia oleracea] 63 2e-07 emb|CDO97759.1| unnamed protein product [Coffea canephora] 62 3e-07 ref|XP_010685180.1| PREDICTED: exocyst complex component EXO84B ... 62 4e-07 ref|XP_009769784.1| PREDICTED: exocyst complex component EXO84B ... 62 4e-07 ref|XP_010063639.1| PREDICTED: exocyst complex component EXO84B ... 62 4e-07 ref|XP_007142142.1| hypothetical protein PHAVU_008G256000g [Phas... 62 4e-07 gb|ABR17710.1| unknown [Picea sitchensis] 62 5e-07 ref|XP_006582989.1| PREDICTED: exocyst complex component EXO84B-... 62 5e-07 ref|XP_006342868.1| PREDICTED: uncharacterized protein LOC102578... 62 5e-07 ref|XP_004235510.1| PREDICTED: exocyst complex component EXO84B ... 62 5e-07 ref|XP_003529713.1| PREDICTED: exocyst complex component EXO84B-... 62 5e-07 ref|XP_009333985.1| PREDICTED: exocyst complex component EXO84B-... 61 7e-07 ref|XP_008342408.1| PREDICTED: exocyst complex component EXO84B-... 61 7e-07 ref|XP_009622289.1| PREDICTED: exocyst complex component EXO84B ... 61 9e-07 ref|XP_012856548.1| PREDICTED: exocyst complex component EXO84B ... 61 9e-07 >ref|XP_010259752.1| PREDICTED: exocyst complex component EXO84B-like [Nelumbo nucifera] Length = 776 Score = 78.2 bits (191), Expect = 5e-12 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -3 Query: 732 TTGKDPYGILPEDEWFMDLAQEAIERLTGKARATNGDRDPN 610 TTG DPY +LPEDEWF+D+ QEAIERLTGK+RA NGDRDPN Sbjct: 716 TTGMDPYSVLPEDEWFIDICQEAIERLTGKSRAVNGDRDPN 756 >emb|CBI25283.3| unnamed protein product [Vitis vinifera] Length = 359 Score = 70.9 bits (172), Expect = 8e-10 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -3 Query: 732 TTGKDPYGILPEDEWFMDLAQEAIERLTGKARATNGDRDPN 610 +TG DPY +LPEDEWF D+ QEA+ERL+GK +A NGDRDPN Sbjct: 299 STGMDPYSVLPEDEWFTDICQEAMERLSGKPKAINGDRDPN 339 >ref|XP_002273667.1| PREDICTED: exocyst complex component EXO84B [Vitis vinifera] Length = 769 Score = 70.9 bits (172), Expect = 8e-10 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -3 Query: 732 TTGKDPYGILPEDEWFMDLAQEAIERLTGKARATNGDRDPN 610 +TG DPY +LPEDEWF D+ QEA+ERL+GK +A NGDRDPN Sbjct: 709 STGMDPYSVLPEDEWFTDICQEAMERLSGKPKAINGDRDPN 749 >ref|XP_008462226.1| PREDICTED: exocyst complex component EXO84B [Cucumis melo] Length = 765 Score = 65.9 bits (159), Expect = 3e-08 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -3 Query: 732 TTGKDPYGILPEDEWFMDLAQEAIERLTGKARATNGDRDPN 610 TTG DP +LPEDEWF D+ Q+AIERL+G+ +A NGDRDPN Sbjct: 705 TTGIDPDSVLPEDEWFNDVCQDAIERLSGRPKAINGDRDPN 745 >ref|XP_004141739.1| PREDICTED: exocyst complex component EXO84B [Cucumis sativus] gi|700190196|gb|KGN45429.1| hypothetical protein Csa_7G447910 [Cucumis sativus] Length = 765 Score = 65.9 bits (159), Expect = 3e-08 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -3 Query: 732 TTGKDPYGILPEDEWFMDLAQEAIERLTGKARATNGDRDPN 610 TTG DP +LPEDEWF D+ Q+AIERL+G+ +A NGDRDPN Sbjct: 705 TTGIDPDSVLPEDEWFNDVCQDAIERLSGRPKAINGDRDPN 745 >gb|KNA09615.1| hypothetical protein SOVF_152060 [Spinacia oleracea] Length = 757 Score = 62.8 bits (151), Expect = 2e-07 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -3 Query: 729 TGKDPYGILPEDEWFMDLAQEAIERLTGKARATNGDRDPN 610 TG+DPY +LPED WF D+ Q+AIE L+GK R NG+R+PN Sbjct: 698 TGRDPYSVLPEDNWFNDICQDAIELLSGKPREINGEREPN 737 >emb|CDO97759.1| unnamed protein product [Coffea canephora] Length = 775 Score = 62.4 bits (150), Expect = 3e-07 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -3 Query: 732 TTGKDPYGILPEDEWFMDLAQEAIERLTGKARATNGDRDPN 610 +TG DP +LPEDEWF+D+ QEAIERL+GK + NG+RD N Sbjct: 715 STGVDPNSVLPEDEWFVDICQEAIERLSGKPKVANGERDLN 755 >ref|XP_010685180.1| PREDICTED: exocyst complex component EXO84B [Beta vulgaris subsp. vulgaris] gi|870852817|gb|KMT04698.1| hypothetical protein BVRB_7g168810 [Beta vulgaris subsp. vulgaris] Length = 765 Score = 62.0 bits (149), Expect = 4e-07 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = -3 Query: 729 TGKDPYGILPEDEWFMDLAQEAIERLTGKARATNGDRDPN 610 TG+DPY +LPED WF D+ Q+AIE L+G+ R NGDRD N Sbjct: 706 TGRDPYSVLPEDNWFNDICQDAIETLSGRPREINGDRDAN 745 >ref|XP_009769784.1| PREDICTED: exocyst complex component EXO84B [Nicotiana sylvestris] Length = 774 Score = 62.0 bits (149), Expect = 4e-07 Identities = 24/41 (58%), Positives = 34/41 (82%) Frame = -3 Query: 732 TTGKDPYGILPEDEWFMDLAQEAIERLTGKARATNGDRDPN 610 +TG DPY +LP+D+WF ++AQ+AIERL+GK + NG+RD N Sbjct: 714 STGMDPYSVLPDDDWFTEIAQDAIERLSGKPKVANGERDLN 754 >ref|XP_010063639.1| PREDICTED: exocyst complex component EXO84B [Eucalyptus grandis] gi|702381309|ref|XP_010063640.1| PREDICTED: exocyst complex component EXO84B [Eucalyptus grandis] gi|629105408|gb|KCW70877.1| hypothetical protein EUGRSUZ_F04008 [Eucalyptus grandis] Length = 767 Score = 62.0 bits (149), Expect = 4e-07 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = -3 Query: 729 TGKDPYGILPEDEWFMDLAQEAIERLTGKARATNGDRDPN 610 TG DPY +LPEDEWF ++ Q+AI+RL+GK RA NGD++ N Sbjct: 708 TGMDPYSVLPEDEWFNEVCQDAIDRLSGKPRAINGDKEVN 747 >ref|XP_007142142.1| hypothetical protein PHAVU_008G256000g [Phaseolus vulgaris] gi|561015275|gb|ESW14136.1| hypothetical protein PHAVU_008G256000g [Phaseolus vulgaris] Length = 769 Score = 62.0 bits (149), Expect = 4e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -3 Query: 729 TGKDPYGILPEDEWFMDLAQEAIERLTGKARATNGDRDPN 610 TG DPY LPEDEWF DL Q+A+ERL+GK + NG++DPN Sbjct: 710 TGMDPYRELPEDEWFNDLCQDAMERLSGKPKEINGEKDPN 749 >gb|ABR17710.1| unknown [Picea sitchensis] Length = 536 Score = 61.6 bits (148), Expect = 5e-07 Identities = 24/41 (58%), Positives = 35/41 (85%) Frame = -3 Query: 732 TTGKDPYGILPEDEWFMDLAQEAIERLTGKARATNGDRDPN 610 ++G DP +LPED+WF+D+A EAI +LTG++R+ NGDR+PN Sbjct: 476 SSGMDPNSVLPEDDWFVDVAHEAILKLTGRSRSANGDREPN 516 >ref|XP_006582989.1| PREDICTED: exocyst complex component EXO84B-like isoform X2 [Glycine max] Length = 642 Score = 61.6 bits (148), Expect = 5e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -3 Query: 729 TGKDPYGILPEDEWFMDLAQEAIERLTGKARATNGDRDPN 610 TG DPYG LPEDEWF D+ Q+A+ERL+GK + NG+RD N Sbjct: 583 TGMDPYGELPEDEWFNDICQDAMERLSGKPKEINGERDLN 622 >ref|XP_006342868.1| PREDICTED: uncharacterized protein LOC102578846 [Solanum tuberosum] Length = 772 Score = 61.6 bits (148), Expect = 5e-07 Identities = 24/40 (60%), Positives = 33/40 (82%) Frame = -3 Query: 729 TGKDPYGILPEDEWFMDLAQEAIERLTGKARATNGDRDPN 610 TG DPY +LPEDEWF ++AQ+A+E+L+GK + NG+RD N Sbjct: 713 TGMDPYSVLPEDEWFTEIAQDAMEKLSGKPKVANGERDLN 752 >ref|XP_004235510.1| PREDICTED: exocyst complex component EXO84B [Solanum lycopersicum] Length = 772 Score = 61.6 bits (148), Expect = 5e-07 Identities = 24/40 (60%), Positives = 33/40 (82%) Frame = -3 Query: 729 TGKDPYGILPEDEWFMDLAQEAIERLTGKARATNGDRDPN 610 TG DPY +LPEDEWF ++AQ+A+E+L+GK + NG+RD N Sbjct: 713 TGMDPYSVLPEDEWFTEIAQDAMEKLSGKPKVANGERDLN 752 >ref|XP_003529713.1| PREDICTED: exocyst complex component EXO84B-like isoform X1 [Glycine max] gi|734418053|gb|KHN39361.1| Exocyst complex component 8 [Glycine soja] gi|947098519|gb|KRH47011.1| hypothetical protein GLYMA_07G003600 [Glycine max] Length = 769 Score = 61.6 bits (148), Expect = 5e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -3 Query: 729 TGKDPYGILPEDEWFMDLAQEAIERLTGKARATNGDRDPN 610 TG DPYG LPEDEWF D+ Q+A+ERL+GK + NG+RD N Sbjct: 710 TGMDPYGELPEDEWFNDICQDAMERLSGKPKEINGERDLN 749 >ref|XP_009333985.1| PREDICTED: exocyst complex component EXO84B-like [Pyrus x bretschneideri] Length = 766 Score = 61.2 bits (147), Expect = 7e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -3 Query: 729 TGKDPYGILPEDEWFMDLAQEAIERLTGKARATNGDRDPN 610 TG DP +LPEDEWF ++ Q+AIERL+GK +A NGDRD N Sbjct: 707 TGMDPNSVLPEDEWFNEVCQDAIERLSGKPKAVNGDRDLN 746 >ref|XP_008342408.1| PREDICTED: exocyst complex component EXO84B-like [Malus domestica] Length = 766 Score = 61.2 bits (147), Expect = 7e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -3 Query: 729 TGKDPYGILPEDEWFMDLAQEAIERLTGKARATNGDRDPN 610 TG DP +LPEDEWF ++ Q+AIERL+GK +A NGDRD N Sbjct: 707 TGMDPNSVLPEDEWFNEVCQDAIERLSGKPKAVNGDRDLN 746 >ref|XP_009622289.1| PREDICTED: exocyst complex component EXO84B [Nicotiana tomentosiformis] Length = 774 Score = 60.8 bits (146), Expect = 9e-07 Identities = 23/41 (56%), Positives = 34/41 (82%) Frame = -3 Query: 732 TTGKDPYGILPEDEWFMDLAQEAIERLTGKARATNGDRDPN 610 +TG DPY +LP+D+WF ++AQ+A+ERL+GK + NG+RD N Sbjct: 714 STGMDPYSVLPDDDWFTEIAQDAMERLSGKPKVANGERDLN 754 >ref|XP_012856548.1| PREDICTED: exocyst complex component EXO84B [Erythranthe guttatus] gi|604301641|gb|EYU21227.1| hypothetical protein MIMGU_mgv1a001664mg [Erythranthe guttata] Length = 777 Score = 60.8 bits (146), Expect = 9e-07 Identities = 24/40 (60%), Positives = 33/40 (82%) Frame = -3 Query: 729 TGKDPYGILPEDEWFMDLAQEAIERLTGKARATNGDRDPN 610 +G DP +LPED+WF ++ Q+AIERL+GK + TNG+RDPN Sbjct: 718 SGLDPNSVLPEDDWFNEICQDAIERLSGKPKMTNGERDPN 757