BLASTX nr result
ID: Papaver31_contig00022088
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00022088 (570 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB56964.1| hypothetical protein B456_009G143900 [Gossypium r... 55 4e-06 ref|XP_012446653.1| PREDICTED: protein Brevis radix-like 2 [Goss... 55 4e-06 gb|KHG14377.1| Protein Brevis radix-like 2 [Gossypium arboreum] 54 9e-06 >gb|KJB56964.1| hypothetical protein B456_009G143900 [Gossypium raimondii] Length = 371 Score = 55.1 bits (131), Expect(2) = 4e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -3 Query: 136 SGRTGSFVSMDEEEAKEWVTQVKLGLLVTFVSMPEEG 26 SGRTGS V M+E+E KEWV QV+ G+L+TFVS+PE G Sbjct: 122 SGRTGSAVFMEEDEPKEWVAQVEPGVLITFVSLPEGG 158 Score = 22.3 bits (46), Expect(2) = 4e-06 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -2 Query: 32 GGNDLKRILF 3 GGNDLKRI F Sbjct: 157 GGNDLKRIRF 166 >ref|XP_012446653.1| PREDICTED: protein Brevis radix-like 2 [Gossypium raimondii] gi|763789967|gb|KJB56963.1| hypothetical protein B456_009G143900 [Gossypium raimondii] gi|763789969|gb|KJB56965.1| hypothetical protein B456_009G143900 [Gossypium raimondii] Length = 368 Score = 55.1 bits (131), Expect(2) = 4e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -3 Query: 136 SGRTGSFVSMDEEEAKEWVTQVKLGLLVTFVSMPEEG 26 SGRTGS V M+E+E KEWV QV+ G+L+TFVS+PE G Sbjct: 122 SGRTGSAVFMEEDEPKEWVAQVEPGVLITFVSLPEGG 158 Score = 22.3 bits (46), Expect(2) = 4e-06 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -2 Query: 32 GGNDLKRILF 3 GGNDLKRI F Sbjct: 157 GGNDLKRIRF 166 >gb|KHG14377.1| Protein Brevis radix-like 2 [Gossypium arboreum] Length = 342 Score = 53.9 bits (128), Expect(2) = 9e-06 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = -3 Query: 136 SGRTGSFVSMDEEEAKEWVTQVKLGLLVTFVSMPEEG 26 SGRTGS + M+E+E KEWV QV+ G+L+TFVS+PE G Sbjct: 122 SGRTGSALFMEEDEPKEWVAQVEPGVLITFVSLPEGG 158 Score = 22.3 bits (46), Expect(2) = 9e-06 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -2 Query: 32 GGNDLKRILF 3 GGNDLKRI F Sbjct: 157 GGNDLKRIRF 166