BLASTX nr result
ID: Papaver31_contig00021399
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00021399 (495 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010917721.1| PREDICTED: probable receptor-like protein ki... 62 1e-07 ref|XP_008221745.1| PREDICTED: probable receptor-like protein ki... 61 4e-07 ref|XP_002523402.1| Protein kinase APK1B, chloroplast precursor,... 60 6e-07 ref|XP_009339196.1| PREDICTED: probable receptor-like protein ki... 60 8e-07 emb|CBI16559.3| unnamed protein product [Vitis vinifera] 60 8e-07 ref|XP_007205337.1| hypothetical protein PRUPE_ppa007026mg [Prun... 60 8e-07 ref|XP_002285747.1| PREDICTED: probable receptor-like protein ki... 60 8e-07 emb|CAN77488.1| hypothetical protein VITISV_020249 [Vitis vinifera] 60 8e-07 ref|XP_010276402.1| PREDICTED: probable receptor-like protein ki... 58 2e-06 >ref|XP_010917721.1| PREDICTED: probable receptor-like protein kinase At5g56460 [Elaeis guineensis] Length = 367 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 103 MGNCWFRWKPSIYRVSSNAKSDSPKVESPTKEEE 2 MGNCWFR PSIYRVSSNAK +SPK++SP KEEE Sbjct: 1 MGNCWFRGNPSIYRVSSNAKFESPKIQSPGKEEE 34 >ref|XP_008221745.1| PREDICTED: probable receptor-like protein kinase At5g56460 [Prunus mume] Length = 385 Score = 60.8 bits (146), Expect = 4e-07 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -3 Query: 103 MGNCWFRWKPSIYRVSSNAKSDSPKVESPT 14 MGNCWFRW+PS+YRVSSNAKS+SPK +SP+ Sbjct: 1 MGNCWFRWEPSVYRVSSNAKSESPKDQSPS 30 >ref|XP_002523402.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus communis] gi|223537352|gb|EEF38981.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus communis] Length = 385 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 103 MGNCWFRWKPSIYRVSSNAKSDSPKVESPT 14 MGNCW RW+PSIYRVSSNAKS+SPK ESP+ Sbjct: 1 MGNCWCRWEPSIYRVSSNAKSESPKCESPS 30 >ref|XP_009339196.1| PREDICTED: probable receptor-like protein kinase At5g56460 [Pyrus x bretschneideri] Length = 385 Score = 59.7 bits (143), Expect = 8e-07 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = -3 Query: 103 MGNCWFRWKPSIYRVSSNAKSDSPKVESPT 14 MGNCW+RW+PS+YRVSSNAKS+SPK +SP+ Sbjct: 1 MGNCWYRWEPSVYRVSSNAKSESPKDQSPS 30 >emb|CBI16559.3| unnamed protein product [Vitis vinifera] Length = 277 Score = 59.7 bits (143), Expect = 8e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 103 MGNCWFRWKPSIYRVSSNAKSDSPKVESPT 14 MGNCW RWKPSIYRVSSNAKS+SPK +SP+ Sbjct: 1 MGNCWCRWKPSIYRVSSNAKSESPKDQSPS 30 >ref|XP_007205337.1| hypothetical protein PRUPE_ppa007026mg [Prunus persica] gi|462400979|gb|EMJ06536.1| hypothetical protein PRUPE_ppa007026mg [Prunus persica] Length = 385 Score = 59.7 bits (143), Expect = 8e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -3 Query: 103 MGNCWFRWKPSIYRVSSNAKSDSPKVESPT 14 MGNCW RWKPS+YRVSSNAKS+SPK +SP+ Sbjct: 1 MGNCWVRWKPSVYRVSSNAKSESPKDQSPS 30 >ref|XP_002285747.1| PREDICTED: probable receptor-like protein kinase At5g56460 isoform X1 [Vitis vinifera] Length = 380 Score = 59.7 bits (143), Expect = 8e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 103 MGNCWFRWKPSIYRVSSNAKSDSPKVESPT 14 MGNCW RWKPSIYRVSSNAKS+SPK +SP+ Sbjct: 1 MGNCWCRWKPSIYRVSSNAKSESPKDQSPS 30 >emb|CAN77488.1| hypothetical protein VITISV_020249 [Vitis vinifera] Length = 380 Score = 59.7 bits (143), Expect = 8e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 103 MGNCWFRWKPSIYRVSSNAKSDSPKVESPT 14 MGNCW RWKPSIYRVSSNAKS+SPK +SP+ Sbjct: 1 MGNCWCRWKPSIYRVSSNAKSESPKDQSPS 30 >ref|XP_010276402.1| PREDICTED: probable receptor-like protein kinase At5g56460 [Nelumbo nucifera] Length = 385 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -3 Query: 103 MGNCWFRWKPSIYRVSSNAKSDSPKVESPTKEE 5 MGNCW RWKPSIYRVSSN KS+SPK ++P E Sbjct: 1 MGNCWCRWKPSIYRVSSNVKSESPKYQAPPVRE 33