BLASTX nr result
ID: Papaver31_contig00021045
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00021045 (638 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013448575.1| F-box protein interaction domain protein [Me... 59 2e-06 ref|XP_013448641.1| F-box protein interaction domain protein [Me... 57 9e-06 >ref|XP_013448575.1| F-box protein interaction domain protein [Medicago truncatula] gi|657377758|gb|KEH22602.1| F-box protein interaction domain protein [Medicago truncatula] Length = 409 Score = 58.9 bits (141), Expect = 2e-06 Identities = 33/67 (49%), Positives = 44/67 (65%) Frame = -1 Query: 203 MVSIQSCNGGTGLSFFGEDEIFCDILSRLPIKSLMRFKSVCTDWQLLIEKDSNFINLQLT 24 M S+QS NGG S DE+ +ILSRLP+K+LM+FK VC W+ LI DS+F L L Sbjct: 1 MDSLQS-NGGVLTSVLF-DELITEILSRLPVKTLMQFKCVCKSWKTLISHDSSFTKLHLH 58 Query: 23 RSKSDVN 3 RS+ + + Sbjct: 59 RSRCNTH 65 >ref|XP_013448641.1| F-box protein interaction domain protein [Medicago truncatula] gi|657377824|gb|KEH22668.1| F-box protein interaction domain protein [Medicago truncatula] Length = 418 Score = 57.0 bits (136), Expect = 9e-06 Identities = 29/55 (52%), Positives = 35/55 (63%) Frame = -1 Query: 182 NGGTGLSFFGEDEIFCDILSRLPIKSLMRFKSVCTDWQLLIEKDSNFINLQLTRS 18 NGG S DE+ DILSRLP+K+LM+FK VC W+ LI D +F L L RS Sbjct: 10 NGGAPTSLL-LDELIVDILSRLPVKTLMQFKCVCKSWKTLISHDPSFAKLHLQRS 63