BLASTX nr result
ID: Papaver31_contig00019692
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00019692 (486 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002303462.1| hypothetical protein POPTR_0003s09990g [Popu... 64 6e-08 ref|XP_006368311.1| hypothetical protein POPTR_0001s01500g [Popu... 61 3e-07 ref|XP_011018431.1| PREDICTED: transmembrane protein 45B-like [P... 61 4e-07 ref|XP_007040793.1| C globular stage isoform 1 [Theobroma cacao]... 60 6e-07 ref|XP_011028071.1| PREDICTED: transmembrane protein 45A [Populu... 60 8e-07 ref|XP_008448600.1| PREDICTED: transmembrane protein 45B [Cucumi... 60 8e-07 ref|XP_004146117.1| PREDICTED: transmembrane protein 45B [Cucumi... 60 8e-07 ref|XP_002263042.2| PREDICTED: LOW QUALITY PROTEIN: transmembran... 59 1e-06 emb|CAN68559.1| hypothetical protein VITISV_028486 [Vitis vinifera] 59 1e-06 ref|XP_012475580.1| PREDICTED: transmembrane protein 45B-like [G... 59 2e-06 ref|XP_002519856.1| Transmembrane protein 45a, putative [Ricinus... 59 2e-06 gb|KDO40079.1| hypothetical protein CISIN_1g023730mg [Citrus sin... 57 7e-06 ref|XP_006432590.1| hypothetical protein CICLE_v10002116mg [Citr... 57 7e-06 >ref|XP_002303462.1| hypothetical protein POPTR_0003s09990g [Populus trichocarpa] gi|222840894|gb|EEE78441.1| hypothetical protein POPTR_0003s09990g [Populus trichocarpa] Length = 276 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/37 (83%), Positives = 31/37 (83%) Frame = -1 Query: 486 RGELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSDL 376 RGELLANFQLFSLVFGV V YGFAASRYGHSDL Sbjct: 229 RGELLANFQLFSLVFGVLVTVAASYGFAASRYGHSDL 265 >ref|XP_006368311.1| hypothetical protein POPTR_0001s01500g [Populus trichocarpa] gi|550346216|gb|ERP64880.1| hypothetical protein POPTR_0001s01500g [Populus trichocarpa] Length = 276 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = -1 Query: 486 RGELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSDL 376 RGELLA FQLFS+VFGV V YGFAASRYGHSDL Sbjct: 229 RGELLATFQLFSMVFGVLVAVAAAYGFAASRYGHSDL 265 >ref|XP_011018431.1| PREDICTED: transmembrane protein 45B-like [Populus euphratica] gi|743809114|ref|XP_011018432.1| PREDICTED: transmembrane protein 45B-like [Populus euphratica] Length = 276 Score = 60.8 bits (146), Expect = 4e-07 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 486 RGELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSDL 376 RGELLA FQLFSLVFGV V YGFAASRYGHSDL Sbjct: 229 RGELLATFQLFSLVFGVLVAVAVAYGFAASRYGHSDL 265 >ref|XP_007040793.1| C globular stage isoform 1 [Theobroma cacao] gi|590680193|ref|XP_007040794.1| C globular stage isoform 1 [Theobroma cacao] gi|508778038|gb|EOY25294.1| C globular stage isoform 1 [Theobroma cacao] gi|508778039|gb|EOY25295.1| C globular stage isoform 1 [Theobroma cacao] Length = 274 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -1 Query: 486 RGELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSDL 376 RGELLANFQLFSLV GV V+G YGFAASRY +SDL Sbjct: 229 RGELLANFQLFSLVLGVLVAVVGSYGFAASRYANSDL 265 >ref|XP_011028071.1| PREDICTED: transmembrane protein 45A [Populus euphratica] gi|743847801|ref|XP_011028072.1| PREDICTED: transmembrane protein 45A [Populus euphratica] Length = 276 Score = 59.7 bits (143), Expect = 8e-07 Identities = 29/37 (78%), Positives = 29/37 (78%) Frame = -1 Query: 486 RGELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSDL 376 RGELLANFQLFSLVFGV Y FAASRYGHSDL Sbjct: 229 RGELLANFQLFSLVFGVLVTAAASYAFAASRYGHSDL 265 >ref|XP_008448600.1| PREDICTED: transmembrane protein 45B [Cucumis melo] gi|659095476|ref|XP_008448601.1| PREDICTED: transmembrane protein 45B [Cucumis melo] gi|659095478|ref|XP_008448602.1| PREDICTED: transmembrane protein 45B [Cucumis melo] gi|659095480|ref|XP_008448603.1| PREDICTED: transmembrane protein 45B [Cucumis melo] Length = 274 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -1 Query: 486 RGELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSDL 376 RGELLANFQLFS+V GV GV+G Y FAAS+YG SDL Sbjct: 230 RGELLANFQLFSMVIGVLGGVVGVYWFAASKYGRSDL 266 >ref|XP_004146117.1| PREDICTED: transmembrane protein 45B [Cucumis sativus] gi|778674888|ref|XP_011650315.1| PREDICTED: transmembrane protein 45B [Cucumis sativus] gi|778674891|ref|XP_011650316.1| PREDICTED: transmembrane protein 45B [Cucumis sativus] gi|700200565|gb|KGN55698.1| hypothetical protein Csa_3G006600 [Cucumis sativus] Length = 274 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -1 Query: 486 RGELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSDL 376 RGELLANFQLFS+V GV GV+G Y FAAS+YG SDL Sbjct: 230 RGELLANFQLFSMVVGVLGGVIGVYWFAASKYGRSDL 266 >ref|XP_002263042.2| PREDICTED: LOW QUALITY PROTEIN: transmembrane protein 45B-like [Vitis vinifera] Length = 278 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -1 Query: 486 RGELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSDL 376 RGELLANFQLF + FGV V+G YGFAASR+GH DL Sbjct: 229 RGELLANFQLFIIAFGVLVAVVGSYGFAASRFGHPDL 265 >emb|CAN68559.1| hypothetical protein VITISV_028486 [Vitis vinifera] Length = 301 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -1 Query: 486 RGELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSDL 376 RGELLANFQLF + FGV V+G YGFAASR+GH DL Sbjct: 229 RGELLANFQLFIIAFGVLVAVVGSYGFAASRFGHPDL 265 >ref|XP_012475580.1| PREDICTED: transmembrane protein 45B-like [Gossypium raimondii] gi|763757827|gb|KJB25158.1| hypothetical protein B456_004G179300 [Gossypium raimondii] gi|763757828|gb|KJB25159.1| hypothetical protein B456_004G179300 [Gossypium raimondii] gi|763757829|gb|KJB25160.1| hypothetical protein B456_004G179300 [Gossypium raimondii] gi|763757830|gb|KJB25161.1| hypothetical protein B456_004G179300 [Gossypium raimondii] gi|763757831|gb|KJB25162.1| hypothetical protein B456_004G179300 [Gossypium raimondii] gi|763757832|gb|KJB25163.1| hypothetical protein B456_004G179300 [Gossypium raimondii] Length = 272 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -1 Query: 486 RGELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSDL 376 RG+L+ANFQLFSLV GV V+G Y FAASRYG+SDL Sbjct: 228 RGQLIANFQLFSLVLGVLIAVVGLYNFAASRYGNSDL 264 >ref|XP_002519856.1| Transmembrane protein 45a, putative [Ricinus communis] gi|223540902|gb|EEF42460.1| Transmembrane protein 45a, putative [Ricinus communis] Length = 278 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -1 Query: 486 RGELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSDL 376 RGELLANFQLF+LV GV GV+ YGFAAS+YG SDL Sbjct: 229 RGELLANFQLFALVLGVLVGVVVSYGFAASKYGRSDL 265 >gb|KDO40079.1| hypothetical protein CISIN_1g023730mg [Citrus sinensis] Length = 278 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 486 RGELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSD 379 RGE LANFQLF+LVFGV AGV G Y F ASRYG+S+ Sbjct: 229 RGEFLANFQLFALVFGVLAGVAGSYIFVASRYGNSE 264 >ref|XP_006432590.1| hypothetical protein CICLE_v10002116mg [Citrus clementina] gi|567880065|ref|XP_006432591.1| hypothetical protein CICLE_v10002116mg [Citrus clementina] gi|568881565|ref|XP_006493634.1| PREDICTED: transmembrane protein 45B-like [Citrus sinensis] gi|557534712|gb|ESR45830.1| hypothetical protein CICLE_v10002116mg [Citrus clementina] gi|557534713|gb|ESR45831.1| hypothetical protein CICLE_v10002116mg [Citrus clementina] Length = 278 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 486 RGELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSD 379 RGE LANFQLF+LVFGV AGV G Y F ASRYG+S+ Sbjct: 229 RGEFLANFQLFALVFGVLAGVAGSYIFVASRYGNSE 264