BLASTX nr result
ID: Papaver31_contig00017792
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00017792 (526 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAS74379.1| Os01g0753000 [Oryza sativa Japonica Group] 73 9e-11 gb|EEE55394.1| hypothetical protein OsJ_03481 [Oryza sativa Japo... 73 9e-11 gb|EEC71493.1| hypothetical protein OsI_03763 [Oryza sativa Indi... 73 9e-11 dbj|BAH01109.1| unnamed protein product [Oryza sativa Japonica G... 73 9e-11 ref|XP_006644716.1| PREDICTED: transcription factor VOZ1-like [O... 73 9e-11 ref|XP_002458501.1| hypothetical protein SORBIDRAFT_03g034810 [S... 73 9e-11 dbj|BAD87186.1| putative vascular plant one zinc finger protein ... 73 9e-11 ref|XP_003569827.1| PREDICTED: transcription factor VOZ1 [Brachy... 72 1e-10 gb|KRH32693.1| hypothetical protein GLYMA_10G068900 [Glycine max... 72 2e-10 ref|XP_006588835.1| PREDICTED: transcription factor VOZ1-like is... 72 2e-10 ref|XP_006588834.1| PREDICTED: transcription factor VOZ1-like is... 72 2e-10 ref|XP_006588831.1| PREDICTED: transcription factor VOZ1-like is... 72 2e-10 ref|NP_001044270.2| Os01g0753000, partial [Oryza sativa Japonica... 72 2e-10 ref|XP_012702007.1| PREDICTED: transcription factor VOZ1 [Setari... 72 2e-10 gb|AIB05472.1| VOZ transcription factor, partial [Zea mays] 72 2e-10 ref|NP_001151521.1| vascular plant one zinc finger protein [Zea ... 72 2e-10 gb|ACF87408.1| unknown [Zea mays] 72 2e-10 ref|XP_008655081.1| PREDICTED: vascular plant one zinc finger pr... 72 2e-10 ref|XP_014516864.1| PREDICTED: transcription factor VOZ1 isoform... 70 5e-10 ref|XP_014516862.1| PREDICTED: transcription factor VOZ1 isoform... 70 5e-10 >dbj|BAS74379.1| Os01g0753000 [Oryza sativa Japonica Group] Length = 534 Score = 72.8 bits (177), Expect = 9e-11 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +3 Query: 174 PLI*DTY*FLGETIREWVFFDKPRRAFESGNRKQRSLPDYSG 299 P + D Y F GE+IREW+FFDKPRRAFESGNRKQRSLPDY+G Sbjct: 328 PELFDLYIFEGESIREWLFFDKPRRAFESGNRKQRSLPDYNG 369 >gb|EEE55394.1| hypothetical protein OsJ_03481 [Oryza sativa Japonica Group] Length = 611 Score = 72.8 bits (177), Expect = 9e-11 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +3 Query: 174 PLI*DTY*FLGETIREWVFFDKPRRAFESGNRKQRSLPDYSG 299 P + D Y F GE+IREW+FFDKPRRAFESGNRKQRSLPDY+G Sbjct: 405 PELFDLYIFEGESIREWLFFDKPRRAFESGNRKQRSLPDYNG 446 >gb|EEC71493.1| hypothetical protein OsI_03763 [Oryza sativa Indica Group] Length = 542 Score = 72.8 bits (177), Expect = 9e-11 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +3 Query: 174 PLI*DTY*FLGETIREWVFFDKPRRAFESGNRKQRSLPDYSG 299 P + D Y F GE+IREW+FFDKPRRAFESGNRKQRSLPDY+G Sbjct: 336 PELFDLYIFEGESIREWLFFDKPRRAFESGNRKQRSLPDYNG 377 >dbj|BAH01109.1| unnamed protein product [Oryza sativa Japonica Group] Length = 429 Score = 72.8 bits (177), Expect = 9e-11 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +3 Query: 174 PLI*DTY*FLGETIREWVFFDKPRRAFESGNRKQRSLPDYSG 299 P + D Y F GE+IREW+FFDKPRRAFESGNRKQRSLPDY+G Sbjct: 223 PELFDLYIFEGESIREWLFFDKPRRAFESGNRKQRSLPDYNG 264 >ref|XP_006644716.1| PREDICTED: transcription factor VOZ1-like [Oryza brachyantha] Length = 554 Score = 72.8 bits (177), Expect = 9e-11 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +3 Query: 174 PLI*DTY*FLGETIREWVFFDKPRRAFESGNRKQRSLPDYSG 299 P + D Y F GE+IREW+FFDKPRRAFESGNRKQRSLPDY+G Sbjct: 348 PELFDLYIFEGESIREWLFFDKPRRAFESGNRKQRSLPDYTG 389 >ref|XP_002458501.1| hypothetical protein SORBIDRAFT_03g034810 [Sorghum bicolor] gi|241930476|gb|EES03621.1| hypothetical protein SORBIDRAFT_03g034810 [Sorghum bicolor] Length = 562 Score = 72.8 bits (177), Expect = 9e-11 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +3 Query: 174 PLI*DTY*FLGETIREWVFFDKPRRAFESGNRKQRSLPDYSG 299 P + D Y F GE+IREW+FFDKPRRAF+SGNRKQRSLPDYSG Sbjct: 356 PELFDLYIFEGESIREWLFFDKPRRAFDSGNRKQRSLPDYSG 397 >dbj|BAD87186.1| putative vascular plant one zinc finger protein [Oryza sativa Japonica Group] Length = 558 Score = 72.8 bits (177), Expect = 9e-11 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +3 Query: 174 PLI*DTY*FLGETIREWVFFDKPRRAFESGNRKQRSLPDYSG 299 P + D Y F GE+IREW+FFDKPRRAFESGNRKQRSLPDY+G Sbjct: 352 PELFDLYIFEGESIREWLFFDKPRRAFESGNRKQRSLPDYNG 393 >ref|XP_003569827.1| PREDICTED: transcription factor VOZ1 [Brachypodium distachyon] gi|944074279|gb|KQK09763.1| hypothetical protein BRADI_2g50070 [Brachypodium distachyon] Length = 550 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = +3 Query: 174 PLI*DTY*FLGETIREWVFFDKPRRAFESGNRKQRSLPDYSG 299 P + D Y F GE+IREW+FFDKPRRAFESGNRKQRSLPDY G Sbjct: 348 PELFDLYIFEGESIREWLFFDKPRRAFESGNRKQRSLPDYGG 389 >gb|KRH32693.1| hypothetical protein GLYMA_10G068900 [Glycine max] gi|947083973|gb|KRH32694.1| hypothetical protein GLYMA_10G068900 [Glycine max] Length = 381 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = +3 Query: 174 PLI*DTY*FLGETIREWVFFDKPRRAFESGNRKQRSLPDYSG 299 P + DT GETIREW+FFDKPRRAFESGNRKQRSLPDYSG Sbjct: 239 PELFDTCVLEGETIREWLFFDKPRRAFESGNRKQRSLPDYSG 280 >ref|XP_006588835.1| PREDICTED: transcription factor VOZ1-like isoform X5 [Glycine max] gi|947083978|gb|KRH32699.1| hypothetical protein GLYMA_10G068900 [Glycine max] gi|947083979|gb|KRH32700.1| hypothetical protein GLYMA_10G068900 [Glycine max] gi|947083980|gb|KRH32701.1| hypothetical protein GLYMA_10G068900 [Glycine max] gi|947083981|gb|KRH32702.1| hypothetical protein GLYMA_10G068900 [Glycine max] Length = 415 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = +3 Query: 174 PLI*DTY*FLGETIREWVFFDKPRRAFESGNRKQRSLPDYSG 299 P + DT GETIREW+FFDKPRRAFESGNRKQRSLPDYSG Sbjct: 239 PELFDTCVLEGETIREWLFFDKPRRAFESGNRKQRSLPDYSG 280 >ref|XP_006588834.1| PREDICTED: transcription factor VOZ1-like isoform X4 [Glycine max] gi|947083970|gb|KRH32691.1| hypothetical protein GLYMA_10G068900 [Glycine max] gi|947083971|gb|KRH32692.1| hypothetical protein GLYMA_10G068900 [Glycine max] Length = 431 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = +3 Query: 174 PLI*DTY*FLGETIREWVFFDKPRRAFESGNRKQRSLPDYSG 299 P + DT GETIREW+FFDKPRRAFESGNRKQRSLPDYSG Sbjct: 289 PELFDTCVLEGETIREWLFFDKPRRAFESGNRKQRSLPDYSG 330 >ref|XP_006588831.1| PREDICTED: transcription factor VOZ1-like isoform X1 [Glycine max] gi|571482021|ref|XP_006588832.1| PREDICTED: transcription factor VOZ1-like isoform X2 [Glycine max] gi|571482023|ref|XP_006588833.1| PREDICTED: transcription factor VOZ1-like isoform X3 [Glycine max] gi|734402776|gb|KHN32237.1| hypothetical protein glysoja_042664 [Glycine soja] gi|947083974|gb|KRH32695.1| hypothetical protein GLYMA_10G068900 [Glycine max] gi|947083975|gb|KRH32696.1| hypothetical protein GLYMA_10G068900 [Glycine max] gi|947083976|gb|KRH32697.1| hypothetical protein GLYMA_10G068900 [Glycine max] gi|947083977|gb|KRH32698.1| hypothetical protein GLYMA_10G068900 [Glycine max] Length = 465 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = +3 Query: 174 PLI*DTY*FLGETIREWVFFDKPRRAFESGNRKQRSLPDYSG 299 P + DT GETIREW+FFDKPRRAFESGNRKQRSLPDYSG Sbjct: 289 PELFDTCVLEGETIREWLFFDKPRRAFESGNRKQRSLPDYSG 330 >ref|NP_001044270.2| Os01g0753000, partial [Oryza sativa Japonica Group] gi|255673693|dbj|BAF06184.2| Os01g0753000, partial [Oryza sativa Japonica Group] Length = 216 Score = 72.0 bits (175), Expect = 2e-10 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +3 Query: 186 DTY*FLGETIREWVFFDKPRRAFESGNRKQRSLPDYSG 299 D Y F GE+IREW+FFDKPRRAFESGNRKQRSLPDY+G Sbjct: 14 DLYIFEGESIREWLFFDKPRRAFESGNRKQRSLPDYNG 51 >ref|XP_012702007.1| PREDICTED: transcription factor VOZ1 [Setaria italica] gi|944242698|gb|KQL07006.1| hypothetical protein SETIT_000864mg [Setaria italica] Length = 561 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = +3 Query: 174 PLI*DTY*FLGETIREWVFFDKPRRAFESGNRKQRSLPDYSG 299 P + D Y F GE+IREW+FFDKPRRAF+SGNRKQRSLPDY+G Sbjct: 355 PELFDLYIFEGESIREWLFFDKPRRAFDSGNRKQRSLPDYNG 396 >gb|AIB05472.1| VOZ transcription factor, partial [Zea mays] Length = 652 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = +3 Query: 174 PLI*DTY*FLGETIREWVFFDKPRRAFESGNRKQRSLPDYSG 299 P + D Y F GE+IREW+FFDKPRRAF+SGNRKQRSLPDY+G Sbjct: 446 PELFDLYIFEGESIREWLFFDKPRRAFDSGNRKQRSLPDYNG 487 >ref|NP_001151521.1| vascular plant one zinc finger protein [Zea mays] gi|195647394|gb|ACG43165.1| vascular plant one zinc finger protein [Zea mays] Length = 394 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = +3 Query: 174 PLI*DTY*FLGETIREWVFFDKPRRAFESGNRKQRSLPDYSG 299 P + D Y F GE+IREW+FFDKPRRAF+SGNRKQRSLPDY+G Sbjct: 188 PELFDLYIFEGESIREWLFFDKPRRAFDSGNRKQRSLPDYNG 229 >gb|ACF87408.1| unknown [Zea mays] Length = 557 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = +3 Query: 174 PLI*DTY*FLGETIREWVFFDKPRRAFESGNRKQRSLPDYSG 299 P + D Y F GE+IREW+FFDKPRRAF+SGNRKQRSLPDY+G Sbjct: 351 PELFDLYIFEGESIREWLFFDKPRRAFDSGNRKQRSLPDYNG 392 >ref|XP_008655081.1| PREDICTED: vascular plant one zinc finger protein isoform X1 [Zea mays] gi|413952431|gb|AFW85080.1| vascular plant one zinc finger protein [Zea mays] Length = 652 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = +3 Query: 174 PLI*DTY*FLGETIREWVFFDKPRRAFESGNRKQRSLPDYSG 299 P + D Y F GE+IREW+FFDKPRRAF+SGNRKQRSLPDY+G Sbjct: 446 PELFDLYIFEGESIREWLFFDKPRRAFDSGNRKQRSLPDYNG 487 >ref|XP_014516864.1| PREDICTED: transcription factor VOZ1 isoform X2 [Vigna radiata var. radiata] Length = 443 Score = 70.5 bits (171), Expect = 5e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 204 GETIREWVFFDKPRRAFESGNRKQRSLPDYSG 299 GETIREW+FFDKPRRAFESGNRKQRSLPDYSG Sbjct: 300 GETIREWLFFDKPRRAFESGNRKQRSLPDYSG 331 >ref|XP_014516862.1| PREDICTED: transcription factor VOZ1 isoform X1 [Vigna radiata var. radiata] gi|951037271|ref|XP_014516863.1| PREDICTED: transcription factor VOZ1 isoform X1 [Vigna radiata var. radiata] Length = 472 Score = 70.5 bits (171), Expect = 5e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 204 GETIREWVFFDKPRRAFESGNRKQRSLPDYSG 299 GETIREW+FFDKPRRAFESGNRKQRSLPDYSG Sbjct: 300 GETIREWLFFDKPRRAFESGNRKQRSLPDYSG 331