BLASTX nr result
ID: Papaver31_contig00017302
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00017302 (416 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010256804.1| PREDICTED: BTB/POZ and MATH domain-containin... 133 1e-31 ref|XP_010256806.1| PREDICTED: BTB/POZ and MATH domain-containin... 133 1e-31 ref|XP_010256807.1| PREDICTED: BTB/POZ and MATH domain-containin... 133 1e-31 ref|XP_002282536.1| PREDICTED: BTB/POZ and MATH domain-containin... 128 6e-31 ref|XP_010658525.1| PREDICTED: BTB/POZ and MATH domain-containin... 128 6e-31 emb|CBI31621.3| unnamed protein product [Vitis vinifera] 128 6e-31 ref|XP_011002614.1| PREDICTED: BTB/POZ and MATH domain-containin... 125 1e-30 ref|XP_012858464.1| PREDICTED: BTB/POZ and MATH domain-containin... 127 1e-30 ref|XP_012858465.1| PREDICTED: BTB/POZ and MATH domain-containin... 127 1e-30 ref|XP_002316266.1| hypothetical protein POPTR_0010s20670g [Popu... 123 4e-30 ref|XP_004239913.1| PREDICTED: BTB/POZ and MATH domain-containin... 126 3e-29 ref|XP_010321433.1| PREDICTED: BTB/POZ and MATH domain-containin... 126 3e-29 ref|XP_002524218.1| Speckle-type POZ protein, putative [Ricinus ... 122 5e-29 ref|XP_011076789.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and ... 126 6e-29 ref|XP_012450731.1| PREDICTED: BTB/POZ and MATH domain-containin... 122 7e-29 gb|KHG28259.1| BTB/POZ and MATH domain-containing 3 -like protei... 122 7e-29 gb|KJB67619.1| hypothetical protein B456_010G200500 [Gossypium r... 122 7e-29 ref|XP_012450732.1| PREDICTED: BTB/POZ and MATH domain-containin... 122 7e-29 ref|XP_002311186.2| hypothetical protein POPTR_0008s06000g [Popu... 119 9e-29 emb|CDP00137.1| unnamed protein product [Coffea canephora] 131 2e-28 >ref|XP_010256804.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X1 [Nelumbo nucifera] gi|720002817|ref|XP_010256805.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X1 [Nelumbo nucifera] Length = 419 Score = 133 bits (335), Expect(3) = 1e-31 Identities = 60/94 (63%), Positives = 78/94 (82%) Frame = -1 Query: 371 GFAQYMKRSELETSNYLKDDCLNFHCTIGVVKTRVEEGKHYVIPVPPSDMIQSLKSLLES 192 G+ ++ +R+ LETS++LKDDCL HCT+GVV+TR+E K Y IP+PPSDM QSLK LLE+ Sbjct: 141 GYKRFFRRTTLETSDFLKDDCLIMHCTVGVVRTRMEGHKQYNIPIPPSDMGQSLKELLET 200 Query: 191 GTGSDVIIQVGNEFFKAHKLILAGRSPVFKAMFF 90 G GSD++ +VG++ FKAHKLILA RSPVF+A FF Sbjct: 201 GLGSDIVFEVGDDIFKAHKLILAARSPVFRAQFF 234 Score = 28.5 bits (62), Expect(3) = 1e-31 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -2 Query: 94 FFGLVDNPDMNTVAIEEFDPFAF 26 FFGL+ NP+ + V +E+ +P F Sbjct: 233 FFGLIGNPNTDRVVVEDVEPSIF 255 Score = 21.9 bits (45), Expect(3) = 1e-31 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -3 Query: 36 PLPFKAMLLFLY 1 P FKAMLLF+Y Sbjct: 252 PSIFKAMLLFMY 263 >ref|XP_010256806.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X2 [Nelumbo nucifera] Length = 354 Score = 133 bits (335), Expect(3) = 1e-31 Identities = 60/94 (63%), Positives = 78/94 (82%) Frame = -1 Query: 371 GFAQYMKRSELETSNYLKDDCLNFHCTIGVVKTRVEEGKHYVIPVPPSDMIQSLKSLLES 192 G+ ++ +R+ LETS++LKDDCL HCT+GVV+TR+E K Y IP+PPSDM QSLK LLE+ Sbjct: 141 GYKRFFRRTTLETSDFLKDDCLIMHCTVGVVRTRMEGHKQYNIPIPPSDMGQSLKELLET 200 Query: 191 GTGSDVIIQVGNEFFKAHKLILAGRSPVFKAMFF 90 G GSD++ +VG++ FKAHKLILA RSPVF+A FF Sbjct: 201 GLGSDIVFEVGDDIFKAHKLILAARSPVFRAQFF 234 Score = 28.5 bits (62), Expect(3) = 1e-31 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -2 Query: 94 FFGLVDNPDMNTVAIEEFDPFAF 26 FFGL+ NP+ + V +E+ +P F Sbjct: 233 FFGLIGNPNTDRVVVEDVEPSIF 255 Score = 21.9 bits (45), Expect(3) = 1e-31 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -3 Query: 36 PLPFKAMLLFLY 1 P FKAMLLF+Y Sbjct: 252 PSIFKAMLLFMY 263 >ref|XP_010256807.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X3 [Nelumbo nucifera] Length = 350 Score = 133 bits (335), Expect(3) = 1e-31 Identities = 60/94 (63%), Positives = 78/94 (82%) Frame = -1 Query: 371 GFAQYMKRSELETSNYLKDDCLNFHCTIGVVKTRVEEGKHYVIPVPPSDMIQSLKSLLES 192 G+ ++ +R+ LETS++LKDDCL HCT+GVV+TR+E K Y IP+PPSDM QSLK LLE+ Sbjct: 141 GYKRFFRRTTLETSDFLKDDCLIMHCTVGVVRTRMEGHKQYNIPIPPSDMGQSLKELLET 200 Query: 191 GTGSDVIIQVGNEFFKAHKLILAGRSPVFKAMFF 90 G GSD++ +VG++ FKAHKLILA RSPVF+A FF Sbjct: 201 GLGSDIVFEVGDDIFKAHKLILAARSPVFRAQFF 234 Score = 28.5 bits (62), Expect(3) = 1e-31 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -2 Query: 94 FFGLVDNPDMNTVAIEEFDPFAF 26 FFGL+ NP+ + V +E+ +P F Sbjct: 233 FFGLIGNPNTDRVVVEDVEPSIF 255 Score = 21.9 bits (45), Expect(3) = 1e-31 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -3 Query: 36 PLPFKAMLLFLY 1 P FKAMLLF+Y Sbjct: 252 PSIFKAMLLFMY 263 >ref|XP_002282536.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X1 [Vitis vinifera] Length = 406 Score = 128 bits (321), Expect(3) = 6e-31 Identities = 59/94 (62%), Positives = 74/94 (78%) Frame = -1 Query: 371 GFAQYMKRSELETSNYLKDDCLNFHCTIGVVKTRVEEGKHYVIPVPPSDMIQSLKSLLES 192 G+ ++ +R+ LETS+++KDDCL HCT+GVV+TRVE K Y IP+PPSD+ QSLK LLES Sbjct: 129 GYKRFFRRTTLETSDFIKDDCLAMHCTVGVVRTRVEGPKQYTIPIPPSDIGQSLKDLLES 188 Query: 191 GTGSDVIIQVGNEFFKAHKLILAGRSPVFKAMFF 90 G D+ QV +E FKAHKLILA RSPVF+A FF Sbjct: 189 EVGCDITFQVADETFKAHKLILAARSPVFRAQFF 222 Score = 31.2 bits (69), Expect(3) = 6e-31 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -2 Query: 94 FFGLVDNPDMNTVAIEEFDPFAF 26 FFGLV NP+M+ V +E+ +P F Sbjct: 221 FFGLVGNPNMDKVVVEDVEPSIF 243 Score = 21.9 bits (45), Expect(3) = 6e-31 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -3 Query: 36 PLPFKAMLLFLY 1 P FKAMLLF+Y Sbjct: 240 PSIFKAMLLFIY 251 >ref|XP_010658525.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X2 [Vitis vinifera] Length = 341 Score = 128 bits (321), Expect(3) = 6e-31 Identities = 59/94 (62%), Positives = 74/94 (78%) Frame = -1 Query: 371 GFAQYMKRSELETSNYLKDDCLNFHCTIGVVKTRVEEGKHYVIPVPPSDMIQSLKSLLES 192 G+ ++ +R+ LETS+++KDDCL HCT+GVV+TRVE K Y IP+PPSD+ QSLK LLES Sbjct: 129 GYKRFFRRTTLETSDFIKDDCLAMHCTVGVVRTRVEGPKQYTIPIPPSDIGQSLKDLLES 188 Query: 191 GTGSDVIIQVGNEFFKAHKLILAGRSPVFKAMFF 90 G D+ QV +E FKAHKLILA RSPVF+A FF Sbjct: 189 EVGCDITFQVADETFKAHKLILAARSPVFRAQFF 222 Score = 31.2 bits (69), Expect(3) = 6e-31 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -2 Query: 94 FFGLVDNPDMNTVAIEEFDPFAF 26 FFGLV NP+M+ V +E+ +P F Sbjct: 221 FFGLVGNPNMDKVVVEDVEPSIF 243 Score = 21.9 bits (45), Expect(3) = 6e-31 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -3 Query: 36 PLPFKAMLLFLY 1 P FKAMLLF+Y Sbjct: 240 PSIFKAMLLFIY 251 >emb|CBI31621.3| unnamed protein product [Vitis vinifera] Length = 335 Score = 128 bits (321), Expect(3) = 6e-31 Identities = 59/94 (62%), Positives = 74/94 (78%) Frame = -1 Query: 371 GFAQYMKRSELETSNYLKDDCLNFHCTIGVVKTRVEEGKHYVIPVPPSDMIQSLKSLLES 192 G+ ++ +R+ LETS+++KDDCL HCT+GVV+TRVE K Y IP+PPSD+ QSLK LLES Sbjct: 58 GYKRFFRRTTLETSDFIKDDCLAMHCTVGVVRTRVEGPKQYTIPIPPSDIGQSLKDLLES 117 Query: 191 GTGSDVIIQVGNEFFKAHKLILAGRSPVFKAMFF 90 G D+ QV +E FKAHKLILA RSPVF+A FF Sbjct: 118 EVGCDITFQVADETFKAHKLILAARSPVFRAQFF 151 Score = 31.2 bits (69), Expect(3) = 6e-31 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -2 Query: 94 FFGLVDNPDMNTVAIEEFDPFAF 26 FFGLV NP+M+ V +E+ +P F Sbjct: 150 FFGLVGNPNMDKVVVEDVEPSIF 172 Score = 21.9 bits (45), Expect(3) = 6e-31 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -3 Query: 36 PLPFKAMLLFLY 1 P FKAMLLF+Y Sbjct: 169 PSIFKAMLLFIY 180 >ref|XP_011002614.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like [Populus euphratica] Length = 408 Score = 125 bits (313), Expect(3) = 1e-30 Identities = 60/94 (63%), Positives = 73/94 (77%) Frame = -1 Query: 371 GFAQYMKRSELETSNYLKDDCLNFHCTIGVVKTRVEEGKHYVIPVPPSDMIQSLKSLLES 192 G+ ++ +R+ LETS+YLKDDCL +CT+GVV+TR+E K Y I VPPSDM Q LK LLES Sbjct: 129 GYKRFFRRTTLETSDYLKDDCLIMNCTVGVVRTRLEGPKQYSISVPPSDMGQGLKELLES 188 Query: 191 GTGSDVIIQVGNEFFKAHKLILAGRSPVFKAMFF 90 G D+ QVG+E FKAHKLILA RSPVF+A FF Sbjct: 189 EAGCDIAFQVGDETFKAHKLILAARSPVFRAQFF 222 Score = 30.8 bits (68), Expect(3) = 1e-30 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -2 Query: 94 FFGLVDNPDMNTVAIEEFDPFAF 26 FFGLV +P M+ VA+++ DP F Sbjct: 221 FFGLVGDPKMDKVAVKDVDPLIF 243 Score = 24.6 bits (52), Expect(3) = 1e-30 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -3 Query: 51 LKSSIPLPFKAMLLFLY 1 +K PL FKAMLLF+Y Sbjct: 235 VKDVDPLIFKAMLLFIY 251 >ref|XP_012858464.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X1 [Erythranthe guttatus] gi|604300101|gb|EYU19944.1| hypothetical protein MIMGU_mgv1a007421mg [Erythranthe guttata] Length = 408 Score = 127 bits (320), Expect(2) = 1e-30 Identities = 60/94 (63%), Positives = 75/94 (79%) Frame = -1 Query: 371 GFAQYMKRSELETSNYLKDDCLNFHCTIGVVKTRVEEGKHYVIPVPPSDMIQSLKSLLES 192 G+ ++ +R+ LETS++LKDDCL+ HCT+GVV+TRVE K Y + VPPSDM QSLK LL+S Sbjct: 131 GYKRFFRRTSLETSDFLKDDCLSMHCTVGVVRTRVEGPKSYSVIVPPSDMGQSLKYLLDS 190 Query: 191 GTGSDVIIQVGNEFFKAHKLILAGRSPVFKAMFF 90 TG D+ QVG E F+AHKLILA RSPVF+A FF Sbjct: 191 ETGCDITFQVGEESFRAHKLILAARSPVFRAQFF 224 Score = 32.0 bits (71), Expect(2) = 1e-30 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -2 Query: 94 FFGLVDNPDMNTVAIEEFDPFAF 26 FFGLV NP+ + V IE+ +PF F Sbjct: 223 FFGLVGNPNSDKVEIEDVEPFIF 245 >ref|XP_012858465.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X2 [Erythranthe guttatus] gi|604300102|gb|EYU19945.1| hypothetical protein MIMGU_mgv1a007421mg [Erythranthe guttata] Length = 340 Score = 127 bits (320), Expect(2) = 1e-30 Identities = 60/94 (63%), Positives = 75/94 (79%) Frame = -1 Query: 371 GFAQYMKRSELETSNYLKDDCLNFHCTIGVVKTRVEEGKHYVIPVPPSDMIQSLKSLLES 192 G+ ++ +R+ LETS++LKDDCL+ HCT+GVV+TRVE K Y + VPPSDM QSLK LL+S Sbjct: 131 GYKRFFRRTSLETSDFLKDDCLSMHCTVGVVRTRVEGPKSYSVIVPPSDMGQSLKYLLDS 190 Query: 191 GTGSDVIIQVGNEFFKAHKLILAGRSPVFKAMFF 90 TG D+ QVG E F+AHKLILA RSPVF+A FF Sbjct: 191 ETGCDITFQVGEESFRAHKLILAARSPVFRAQFF 224 Score = 32.0 bits (71), Expect(2) = 1e-30 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -2 Query: 94 FFGLVDNPDMNTVAIEEFDPFAF 26 FFGLV NP+ + V IE+ +PF F Sbjct: 223 FFGLVGNPNSDKVEIEDVEPFIF 245 >ref|XP_002316266.1| hypothetical protein POPTR_0010s20670g [Populus trichocarpa] gi|222865306|gb|EEF02437.1| hypothetical protein POPTR_0010s20670g [Populus trichocarpa] Length = 408 Score = 123 bits (308), Expect(3) = 4e-30 Identities = 59/94 (62%), Positives = 72/94 (76%) Frame = -1 Query: 371 GFAQYMKRSELETSNYLKDDCLNFHCTIGVVKTRVEEGKHYVIPVPPSDMIQSLKSLLES 192 G+ ++ +R+ LETS+YLKDDCL +CT+GVV+T +E K Y I VPPSDM Q LK LLES Sbjct: 129 GYKRFFRRTTLETSDYLKDDCLIMNCTVGVVRTHLEGPKQYSISVPPSDMGQGLKELLES 188 Query: 191 GTGSDVIIQVGNEFFKAHKLILAGRSPVFKAMFF 90 G D+ QVG+E FKAHKLILA RSPVF+A FF Sbjct: 189 EAGCDIAFQVGDETFKAHKLILAARSPVFRAQFF 222 Score = 30.8 bits (68), Expect(3) = 4e-30 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -2 Query: 94 FFGLVDNPDMNTVAIEEFDPFAF 26 FFGLV +P M+ VA+++ DP F Sbjct: 221 FFGLVGDPKMDKVAVKDVDPLIF 243 Score = 24.6 bits (52), Expect(3) = 4e-30 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -3 Query: 51 LKSSIPLPFKAMLLFLY 1 +K PL FKAMLLF+Y Sbjct: 235 VKDVDPLIFKAMLLFIY 251 >ref|XP_004239913.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X1 [Solanum lycopersicum] Length = 408 Score = 126 bits (317), Expect(2) = 3e-29 Identities = 57/94 (60%), Positives = 75/94 (79%) Frame = -1 Query: 371 GFAQYMKRSELETSNYLKDDCLNFHCTIGVVKTRVEEGKHYVIPVPPSDMIQSLKSLLES 192 G+ ++ +R+ LETS+YLKDDCL+ HCT+GVV+TRVE K+Y + +PPSDM QSLK LL++ Sbjct: 130 GYKRFFRRASLETSDYLKDDCLSMHCTVGVVRTRVEGPKNYSVTIPPSDMGQSLKYLLDA 189 Query: 191 GTGSDVIIQVGNEFFKAHKLILAGRSPVFKAMFF 90 G D++ +VG E FK HKLILA RSPVF+A FF Sbjct: 190 ELGCDIVFRVGEEAFKGHKLILAARSPVFRAQFF 223 Score = 28.5 bits (62), Expect(2) = 3e-29 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 94 FFGLVDNPDMNTVAIEEFDPFAF 26 FFGL+ NP + V IE+ +P F Sbjct: 222 FFGLIGNPKTDEVEIEDIEPSVF 244 >ref|XP_010321433.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X2 [Solanum lycopersicum] gi|723701918|ref|XP_010321434.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X2 [Solanum lycopersicum] Length = 340 Score = 126 bits (317), Expect(2) = 3e-29 Identities = 57/94 (60%), Positives = 75/94 (79%) Frame = -1 Query: 371 GFAQYMKRSELETSNYLKDDCLNFHCTIGVVKTRVEEGKHYVIPVPPSDMIQSLKSLLES 192 G+ ++ +R+ LETS+YLKDDCL+ HCT+GVV+TRVE K+Y + +PPSDM QSLK LL++ Sbjct: 130 GYKRFFRRASLETSDYLKDDCLSMHCTVGVVRTRVEGPKNYSVTIPPSDMGQSLKYLLDA 189 Query: 191 GTGSDVIIQVGNEFFKAHKLILAGRSPVFKAMFF 90 G D++ +VG E FK HKLILA RSPVF+A FF Sbjct: 190 ELGCDIVFRVGEEAFKGHKLILAARSPVFRAQFF 223 Score = 28.5 bits (62), Expect(2) = 3e-29 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 94 FFGLVDNPDMNTVAIEEFDPFAF 26 FFGL+ NP + V IE+ +P F Sbjct: 222 FFGLIGNPKTDEVEIEDIEPSVF 244 >ref|XP_002524218.1| Speckle-type POZ protein, putative [Ricinus communis] gi|223536495|gb|EEF38142.1| Speckle-type POZ protein, putative [Ricinus communis] Length = 408 Score = 122 bits (307), Expect(3) = 5e-29 Identities = 57/94 (60%), Positives = 73/94 (77%) Frame = -1 Query: 371 GFAQYMKRSELETSNYLKDDCLNFHCTIGVVKTRVEEGKHYVIPVPPSDMIQSLKSLLES 192 G+ ++ +R+ LE S+Y+KDDCL +CT+GVV+TR+E K Y I +PPSDM Q LK LLES Sbjct: 129 GYKRFFRRTTLENSDYIKDDCLIMNCTVGVVRTRLEGPKQYSISLPPSDMGQGLKELLES 188 Query: 191 GTGSDVIIQVGNEFFKAHKLILAGRSPVFKAMFF 90 G D++ QVG+E FKAHKLILA RSPVF+A FF Sbjct: 189 EVGCDIVFQVGDETFKAHKLILAARSPVFRAQFF 222 Score = 30.0 bits (66), Expect(3) = 5e-29 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -2 Query: 94 FFGLVDNPDMNTVAIEEFDPFAF 26 FFGLV +P+++ V +E+ DP F Sbjct: 221 FFGLVGDPNLDKVVVEDIDPSIF 243 Score = 21.9 bits (45), Expect(3) = 5e-29 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -3 Query: 36 PLPFKAMLLFLY 1 P FKAMLLF+Y Sbjct: 240 PSIFKAMLLFIY 251 >ref|XP_011076789.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and MATH domain-containing protein 3 [Sesamum indicum] Length = 399 Score = 126 bits (316), Expect(2) = 6e-29 Identities = 58/94 (61%), Positives = 76/94 (80%) Frame = -1 Query: 371 GFAQYMKRSELETSNYLKDDCLNFHCTIGVVKTRVEEGKHYVIPVPPSDMIQSLKSLLES 192 G+ ++ +R+ LETS++LKDDCL+ +CT+GVV+TRVE K Y +P+PPSDM QSLK LL++ Sbjct: 131 GYKRFFRRTSLETSDFLKDDCLSMNCTVGVVRTRVEGPKLYSVPIPPSDMGQSLKYLLDA 190 Query: 191 GTGSDVIIQVGNEFFKAHKLILAGRSPVFKAMFF 90 G D+I QVG E +KAHKLILA RSPVF+A FF Sbjct: 191 ELGCDIIFQVGEESYKAHKLILAARSPVFRAQFF 224 Score = 28.1 bits (61), Expect(2) = 6e-29 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -2 Query: 94 FFGLVDNPDMNTVAIEEFDPFAF 26 FFGLV NP+ + V +E+ +P F Sbjct: 223 FFGLVGNPNSDKVELEDVEPSIF 245 >ref|XP_012450731.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like isoform X1 [Gossypium raimondii] gi|763800662|gb|KJB67617.1| hypothetical protein B456_010G200500 [Gossypium raimondii] Length = 410 Score = 122 bits (307), Expect(3) = 7e-29 Identities = 58/94 (61%), Positives = 76/94 (80%) Frame = -1 Query: 371 GFAQYMKRSELETSNYLKDDCLNFHCTIGVVKTRVEEGKHYVIPVPPSDMIQSLKSLLES 192 G+ ++ +R+ LE+S+Y+KDDCL +CT+GVV+TR+E K IPVPPSDM Q+L++LLES Sbjct: 132 GYKRFFRRTTLESSDYIKDDCLIMNCTVGVVRTRLEGPKLSSIPVPPSDMGQNLRALLES 191 Query: 191 GTGSDVIIQVGNEFFKAHKLILAGRSPVFKAMFF 90 G D++ QVG+E FKAHKLILA RSPVFKA FF Sbjct: 192 EVGCDIMFQVGDETFKAHKLILAARSPVFKAQFF 225 Score = 29.3 bits (64), Expect(3) = 7e-29 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = -2 Query: 103 KQCFFGLVDNPDMNTVAIEEFDPFAF 26 K FFGLV +P+++ + +++F+P F Sbjct: 221 KAQFFGLVGDPNLDKIVVKDFEPSIF 246 Score = 22.3 bits (46), Expect(3) = 7e-29 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 51 LKSSIPLPFKAMLLFLY 1 +K P FKAMLLF+Y Sbjct: 238 VKDFEPSIFKAMLLFIY 254 >gb|KHG28259.1| BTB/POZ and MATH domain-containing 3 -like protein [Gossypium arboreum] Length = 410 Score = 122 bits (307), Expect(3) = 7e-29 Identities = 58/94 (61%), Positives = 76/94 (80%) Frame = -1 Query: 371 GFAQYMKRSELETSNYLKDDCLNFHCTIGVVKTRVEEGKHYVIPVPPSDMIQSLKSLLES 192 G+ ++ +R+ LE+S+Y+KDDCL +CT+GVV+TR+E K IPVPPSDM Q+L++LLES Sbjct: 132 GYKRFFRRTTLESSDYIKDDCLIMNCTVGVVRTRLEGPKLSSIPVPPSDMGQNLRALLES 191 Query: 191 GTGSDVIIQVGNEFFKAHKLILAGRSPVFKAMFF 90 G D++ QVG+E FKAHKLILA RSPVFKA FF Sbjct: 192 EVGCDIMFQVGDETFKAHKLILAARSPVFKAQFF 225 Score = 29.3 bits (64), Expect(3) = 7e-29 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = -2 Query: 103 KQCFFGLVDNPDMNTVAIEEFDPFAF 26 K FFGLV +P+++ + +++F+P F Sbjct: 221 KAQFFGLVGDPNLDKIVVKDFEPSIF 246 Score = 22.3 bits (46), Expect(3) = 7e-29 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 51 LKSSIPLPFKAMLLFLY 1 +K P FKAMLLF+Y Sbjct: 238 VKDFEPSIFKAMLLFIY 254 >gb|KJB67619.1| hypothetical protein B456_010G200500 [Gossypium raimondii] Length = 353 Score = 122 bits (307), Expect(3) = 7e-29 Identities = 58/94 (61%), Positives = 76/94 (80%) Frame = -1 Query: 371 GFAQYMKRSELETSNYLKDDCLNFHCTIGVVKTRVEEGKHYVIPVPPSDMIQSLKSLLES 192 G+ ++ +R+ LE+S+Y+KDDCL +CT+GVV+TR+E K IPVPPSDM Q+L++LLES Sbjct: 132 GYKRFFRRTTLESSDYIKDDCLIMNCTVGVVRTRLEGPKLSSIPVPPSDMGQNLRALLES 191 Query: 191 GTGSDVIIQVGNEFFKAHKLILAGRSPVFKAMFF 90 G D++ QVG+E FKAHKLILA RSPVFKA FF Sbjct: 192 EVGCDIMFQVGDETFKAHKLILAARSPVFKAQFF 225 Score = 29.3 bits (64), Expect(3) = 7e-29 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = -2 Query: 103 KQCFFGLVDNPDMNTVAIEEFDPFAF 26 K FFGLV +P+++ + +++F+P F Sbjct: 221 KAQFFGLVGDPNLDKIVVKDFEPSIF 246 Score = 22.3 bits (46), Expect(3) = 7e-29 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 51 LKSSIPLPFKAMLLFLY 1 +K P FKAMLLF+Y Sbjct: 238 VKDFEPSIFKAMLLFIY 254 >ref|XP_012450732.1| PREDICTED: BTB/POZ and MATH domain-containing protein 3-like isoform X2 [Gossypium raimondii] gi|763800663|gb|KJB67618.1| hypothetical protein B456_010G200500 [Gossypium raimondii] Length = 352 Score = 122 bits (307), Expect(3) = 7e-29 Identities = 58/94 (61%), Positives = 76/94 (80%) Frame = -1 Query: 371 GFAQYMKRSELETSNYLKDDCLNFHCTIGVVKTRVEEGKHYVIPVPPSDMIQSLKSLLES 192 G+ ++ +R+ LE+S+Y+KDDCL +CT+GVV+TR+E K IPVPPSDM Q+L++LLES Sbjct: 132 GYKRFFRRTTLESSDYIKDDCLIMNCTVGVVRTRLEGPKLSSIPVPPSDMGQNLRALLES 191 Query: 191 GTGSDVIIQVGNEFFKAHKLILAGRSPVFKAMFF 90 G D++ QVG+E FKAHKLILA RSPVFKA FF Sbjct: 192 EVGCDIMFQVGDETFKAHKLILAARSPVFKAQFF 225 Score = 29.3 bits (64), Expect(3) = 7e-29 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = -2 Query: 103 KQCFFGLVDNPDMNTVAIEEFDPFAF 26 K FFGLV +P+++ + +++F+P F Sbjct: 221 KAQFFGLVGDPNLDKIVVKDFEPSIF 246 Score = 22.3 bits (46), Expect(3) = 7e-29 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 51 LKSSIPLPFKAMLLFLY 1 +K P FKAMLLF+Y Sbjct: 238 VKDFEPSIFKAMLLFIY 254 >ref|XP_002311186.2| hypothetical protein POPTR_0008s06000g [Populus trichocarpa] gi|550332520|gb|EEE88553.2| hypothetical protein POPTR_0008s06000g [Populus trichocarpa] Length = 407 Score = 119 bits (298), Expect(3) = 9e-29 Identities = 57/94 (60%), Positives = 72/94 (76%) Frame = -1 Query: 371 GFAQYMKRSELETSNYLKDDCLNFHCTIGVVKTRVEEGKHYVIPVPPSDMIQSLKSLLES 192 G+ ++ +R+ LETS+YLKDDCL +CT+GVV+TR+E K Y I VPPSDM K LLES Sbjct: 129 GYKRFFRRTTLETSDYLKDDCLIMNCTVGVVRTRLEGPKQYSISVPPSDMGWGFKELLES 188 Query: 191 GTGSDVIIQVGNEFFKAHKLILAGRSPVFKAMFF 90 +G D+ QVG+E F+AHKLILA RSPVF+A FF Sbjct: 189 ESGCDIDFQVGDETFRAHKLILAARSPVFRAQFF 222 Score = 30.0 bits (66), Expect(3) = 9e-29 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -2 Query: 94 FFGLVDNPDMNTVAIEEFDPFAF 26 FFGLV +P+M+ V +++ DP F Sbjct: 221 FFGLVGDPNMDKVVVKDVDPLIF 243 Score = 24.6 bits (52), Expect(3) = 9e-29 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -3 Query: 51 LKSSIPLPFKAMLLFLY 1 +K PL FKAMLLF+Y Sbjct: 235 VKDVDPLIFKAMLLFIY 251 >emb|CDP00137.1| unnamed protein product [Coffea canephora] Length = 335 Score = 131 bits (330), Expect = 2e-28 Identities = 63/94 (67%), Positives = 75/94 (79%) Frame = -1 Query: 371 GFAQYMKRSELETSNYLKDDCLNFHCTIGVVKTRVEEGKHYVIPVPPSDMIQSLKSLLES 192 G+ ++ +R+ LETS+YLKDDCL HCT+GVV+TRVE K Y I VPPSDM Q+LK LLES Sbjct: 58 GYKRFFRRTSLETSDYLKDDCLAMHCTVGVVRTRVEGPKQYTISVPPSDMGQNLKYLLES 117 Query: 191 GTGSDVIIQVGNEFFKAHKLILAGRSPVFKAMFF 90 GSD+ QVG+E FKAHKLILA RSPVF+A FF Sbjct: 118 EIGSDITFQVGDEAFKAHKLILAARSPVFRAQFF 151