BLASTX nr result
ID: Papaver31_contig00017251
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00017251 (692 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI24397.3| unnamed protein product [Vitis vinifera] 60 1e-06 ref|XP_002277148.1| PREDICTED: BTB/POZ and MATH domain-containin... 60 1e-06 ref|XP_003632235.1| PREDICTED: BTB/POZ and MATH domain-containin... 60 1e-06 ref|XP_012462451.1| PREDICTED: BTB/POZ and MATH domain-containin... 59 3e-06 ref|XP_012462450.1| PREDICTED: BTB/POZ and MATH domain-containin... 59 3e-06 gb|KHM99118.1| BTB/POZ and MATH domain-containing protein 4 [Gly... 59 3e-06 ref|XP_009762142.1| PREDICTED: BTB/POZ and MATH domain-containin... 59 3e-06 ref|XP_003545187.1| PREDICTED: BTB/POZ and MATH domain-containin... 59 3e-06 ref|XP_010093790.1| BTB/POZ and MATH domain-containing protein 4... 59 4e-06 ref|XP_009606600.1| PREDICTED: BTB/POZ and MATH domain-containin... 59 4e-06 ref|XP_011006172.1| PREDICTED: BTB/POZ and MATH domain-containin... 58 5e-06 ref|XP_010031623.1| PREDICTED: BTB/POZ and MATH domain-containin... 58 5e-06 gb|KCW50988.1| hypothetical protein EUGRSUZ_J00615 [Eucalyptus g... 58 5e-06 gb|KCW50987.1| hypothetical protein EUGRSUZ_J00615 [Eucalyptus g... 58 5e-06 ref|XP_006384724.1| hypothetical protein POPTR_0004s20530g [Popu... 58 5e-06 ref|XP_004493213.1| PREDICTED: BTB/POZ and MATH domain-containin... 58 5e-06 ref|XP_010653194.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and ... 58 6e-06 ref|XP_010685504.1| PREDICTED: BTB/POZ and MATH domain-containin... 58 6e-06 emb|CBI31240.3| unnamed protein product [Vitis vinifera] 58 6e-06 ref|XP_006362728.1| PREDICTED: BTB/POZ and MATH domain-containin... 58 6e-06 >emb|CBI24397.3| unnamed protein product [Vitis vinifera] Length = 405 Score = 60.5 bits (145), Expect = 1e-06 Identities = 36/59 (61%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Frame = -3 Query: 627 LLPYQEGSDVVF*IASEKLHARKLVLDA*SLVFRDELMEGMEEDKCEVV-EDLESNVFK 454 LL EGSDVVF +A EK HA KLVL A S VFR+E + +EED EVV DLE VFK Sbjct: 180 LLENMEGSDVVFDVAGEKFHAHKLVLAARSPVFRNEFFDRLEEDTQEVVITDLEPKVFK 238 >ref|XP_002277148.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 isoform X2 [Vitis vinifera] Length = 411 Score = 60.5 bits (145), Expect = 1e-06 Identities = 36/59 (61%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Frame = -3 Query: 627 LLPYQEGSDVVF*IASEKLHARKLVLDA*SLVFRDELMEGMEEDKCEVV-EDLESNVFK 454 LL EGSDVVF +A EK HA KLVL A S VFR+E + +EED EVV DLE VFK Sbjct: 198 LLENMEGSDVVFDVAGEKFHAHKLVLAARSPVFRNEFFDRLEEDTQEVVITDLEPKVFK 256 >ref|XP_003632235.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 isoform X1 [Vitis vinifera] Length = 423 Score = 60.5 bits (145), Expect = 1e-06 Identities = 36/59 (61%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Frame = -3 Query: 627 LLPYQEGSDVVF*IASEKLHARKLVLDA*SLVFRDELMEGMEEDKCEVV-EDLESNVFK 454 LL EGSDVVF +A EK HA KLVL A S VFR+E + +EED EVV DLE VFK Sbjct: 198 LLENMEGSDVVFDVAGEKFHAHKLVLAARSPVFRNEFFDRLEEDTQEVVITDLEPKVFK 256 >ref|XP_012462451.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 isoform X2 [Gossypium raimondii] Length = 422 Score = 58.9 bits (141), Expect = 3e-06 Identities = 32/59 (54%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Frame = -3 Query: 627 LLPYQEGSDVVF*IASEKLHARKLVLDA*SLVFRDELMEGMEEDKCE-VVEDLESNVFK 454 LL EGSD+ F +A EK H+ KLVL A S VFR E+ +G++E K E V+ DLE VFK Sbjct: 198 LLENMEGSDITFDVAGEKFHSHKLVLAARSPVFRSEIFDGVDEQKKEMVITDLEPRVFK 256 >ref|XP_012462450.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 isoform X1 [Gossypium raimondii] gi|763816788|gb|KJB83640.1| hypothetical protein B456_013G256300 [Gossypium raimondii] Length = 410 Score = 58.9 bits (141), Expect = 3e-06 Identities = 32/59 (54%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Frame = -3 Query: 627 LLPYQEGSDVVF*IASEKLHARKLVLDA*SLVFRDELMEGMEEDKCE-VVEDLESNVFK 454 LL EGSD+ F +A EK H+ KLVL A S VFR E+ +G++E K E V+ DLE VFK Sbjct: 198 LLENMEGSDITFDVAGEKFHSHKLVLAARSPVFRSEIFDGVDEQKKEMVITDLEPRVFK 256 >gb|KHM99118.1| BTB/POZ and MATH domain-containing protein 4 [Glycine soja] Length = 361 Score = 58.9 bits (141), Expect = 3e-06 Identities = 31/60 (51%), Positives = 42/60 (70%), Gaps = 1/60 (1%) Frame = -3 Query: 630 ALLPYQEGSDVVF*IASEKLHARKLVLDA*SLVFRDELMEGMEEDKCE-VVEDLESNVFK 454 ALL EGSD++F +A EK HA KL+L A S FR + ++G++E+K E +V DLE VFK Sbjct: 147 ALLDNMEGSDIIFDVAGEKFHAHKLMLAARSPEFRSKFLDGLDEEKNEIIVTDLEPKVFK 206 >ref|XP_009762142.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like [Nicotiana sylvestris] Length = 405 Score = 58.9 bits (141), Expect = 3e-06 Identities = 35/59 (59%), Positives = 39/59 (66%), Gaps = 1/59 (1%) Frame = -3 Query: 627 LLPYQEGSDVVF*IASEKLHARKLVLDA*SLVFRDELMEGMEEDKCE-VVEDLESNVFK 454 LL EGSDVVF +A EK HA KLVL A S VFR E + +E DK E VV D+E VFK Sbjct: 193 LLENMEGSDVVFSVADEKFHAHKLVLAARSSVFRTEFFDELEGDKQEIVVADMEPTVFK 251 >ref|XP_003545187.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like [Glycine max] gi|947065595|gb|KRH14738.1| hypothetical protein GLYMA_14G045500 [Glycine max] Length = 396 Score = 58.9 bits (141), Expect = 3e-06 Identities = 31/60 (51%), Positives = 42/60 (70%), Gaps = 1/60 (1%) Frame = -3 Query: 630 ALLPYQEGSDVVF*IASEKLHARKLVLDA*SLVFRDELMEGMEEDKCE-VVEDLESNVFK 454 ALL EGSD++F +A EK HA KL+L A S FR + ++G++E+K E +V DLE VFK Sbjct: 182 ALLDNMEGSDIIFDVAGEKFHAHKLMLAARSPEFRSKFLDGLDEEKNEIIVTDLEPKVFK 241 >ref|XP_010093790.1| BTB/POZ and MATH domain-containing protein 4 [Morus notabilis] gi|587865062|gb|EXB54641.1| BTB/POZ and MATH domain-containing protein 4 [Morus notabilis] Length = 401 Score = 58.5 bits (140), Expect = 4e-06 Identities = 33/59 (55%), Positives = 39/59 (66%), Gaps = 1/59 (1%) Frame = -3 Query: 627 LLPYQEGSDVVF*IASEKLHARKLVLDA*SLVFRDELMEGMEEDKCEV-VEDLESNVFK 454 LL EGSD+ F +A EK HA KLVL A S +FR + EG+EE K EV V D+E VFK Sbjct: 185 LLENMEGSDITFDVAGEKFHAHKLVLAARSPIFRSKFFEGLEETKEEVEVTDVEPKVFK 243 >ref|XP_009606600.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like [Nicotiana tomentosiformis] Length = 405 Score = 58.5 bits (140), Expect = 4e-06 Identities = 35/59 (59%), Positives = 39/59 (66%), Gaps = 1/59 (1%) Frame = -3 Query: 627 LLPYQEGSDVVF*IASEKLHARKLVLDA*SLVFRDELMEGMEEDKCE-VVEDLESNVFK 454 LL EGSDVVF +A EK HA KLVL A S VFR E + +E DK E VV D+E VFK Sbjct: 193 LLENMEGSDVVFSVAGEKFHAHKLVLAARSPVFRTEFFDELEGDKQEIVVADMEPTVFK 251 >ref|XP_011006172.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like [Populus euphratica] Length = 397 Score = 58.2 bits (139), Expect = 5e-06 Identities = 31/59 (52%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Frame = -3 Query: 627 LLPYQEGSDVVF*IASEKLHARKLVLDA*SLVFRDELMEGMEEDKCE-VVEDLESNVFK 454 +L EGSDV+F +A EK HA KLVL A S FR + +G+E+D+ E V+ DLE VFK Sbjct: 184 MLDNMEGSDVIFNVAGEKFHAHKLVLSARSPFFRSKFFDGVEKDEKEIVISDLEPKVFK 242 >ref|XP_010031623.1| PREDICTED: BTB/POZ and MATH domain-containing protein 5 [Eucalyptus grandis] Length = 507 Score = 58.2 bits (139), Expect = 5e-06 Identities = 34/59 (57%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Frame = -3 Query: 627 LLPYQEGSDVVF*IASEKLHARKLVLDA*SLVFRDELMEGMEEDKCE-VVEDLESNVFK 454 LL EGSD+ F + EK HA KLVL A S VFR EL +G+ E+K E VV+DLE VFK Sbjct: 294 LLENMEGSDITFDVWGEKFHAHKLVLAARSSVFRSELFDGVGENKQEIVVDDLEPAVFK 352 >gb|KCW50988.1| hypothetical protein EUGRSUZ_J00615 [Eucalyptus grandis] Length = 285 Score = 58.2 bits (139), Expect = 5e-06 Identities = 34/59 (57%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Frame = -3 Query: 627 LLPYQEGSDVVF*IASEKLHARKLVLDA*SLVFRDELMEGMEEDKCE-VVEDLESNVFK 454 LL EGSD+ F + EK HA KLVL A S VFR EL +G+ E+K E VV+DLE VFK Sbjct: 190 LLENMEGSDITFDVWGEKFHAHKLVLAARSSVFRSELFDGVGENKQEIVVDDLEPAVFK 248 >gb|KCW50987.1| hypothetical protein EUGRSUZ_J00615 [Eucalyptus grandis] Length = 403 Score = 58.2 bits (139), Expect = 5e-06 Identities = 34/59 (57%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Frame = -3 Query: 627 LLPYQEGSDVVF*IASEKLHARKLVLDA*SLVFRDELMEGMEEDKCE-VVEDLESNVFK 454 LL EGSD+ F + EK HA KLVL A S VFR EL +G+ E+K E VV+DLE VFK Sbjct: 190 LLENMEGSDITFDVWGEKFHAHKLVLAARSSVFRSELFDGVGENKQEIVVDDLEPAVFK 248 >ref|XP_006384724.1| hypothetical protein POPTR_0004s20530g [Populus trichocarpa] gi|550341492|gb|ERP62521.1| hypothetical protein POPTR_0004s20530g [Populus trichocarpa] Length = 397 Score = 58.2 bits (139), Expect = 5e-06 Identities = 31/59 (52%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Frame = -3 Query: 627 LLPYQEGSDVVF*IASEKLHARKLVLDA*SLVFRDELMEGMEEDKCE-VVEDLESNVFK 454 +L EGSDV+F +A EK HA KLVL A S FR + +G+E+D+ E V+ DLE VFK Sbjct: 184 MLDNMEGSDVIFNVAGEKFHAHKLVLSARSPFFRSKFFDGVEKDEKEIVISDLEPKVFK 242 >ref|XP_004493213.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 [Cicer arietinum] Length = 442 Score = 58.2 bits (139), Expect = 5e-06 Identities = 30/59 (50%), Positives = 38/59 (64%), Gaps = 1/59 (1%) Frame = -3 Query: 627 LLPYQEGSDVVF*IASEKLHARKLVLDA*SLVFRDELMEGMEEDKCE-VVEDLESNVFK 454 LL +EGSD++F + E+ HA KLVL A S F +E MEED C+ VV D+E VFK Sbjct: 201 LLENEEGSDIIFSVGGERFHAHKLVLAARSTAFENEFFNKMEEDDCDVVVTDMEPKVFK 259 >ref|XP_010653194.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and MATH domain-containing protein 4 [Vitis vinifera] Length = 367 Score = 57.8 bits (138), Expect = 6e-06 Identities = 30/59 (50%), Positives = 41/59 (69%), Gaps = 1/59 (1%) Frame = -3 Query: 627 LLPYQEGSDVVF*IASEKLHARKLVLDA*SLVFRDELMEGMEEDKCE-VVEDLESNVFK 454 LL +EGSDV+F ++ EK HA KLVL A S +F E + G E+DK E VV+D++ +FK Sbjct: 189 LLENEEGSDVIFDVSGEKFHAHKLVLAARSPIFESEFINGPEDDKQEIVVKDMDPKIFK 247 >ref|XP_010685504.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 [Beta vulgaris subsp. vulgaris] gi|870853126|gb|KMT05007.1| hypothetical protein BVRB_7g171670 [Beta vulgaris subsp. vulgaris] Length = 398 Score = 57.8 bits (138), Expect = 6e-06 Identities = 32/59 (54%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Frame = -3 Query: 627 LLPYQEGSDVVF*IASEKLHARKLVLDA*SLVFRDELMEGMEEDKCE-VVEDLESNVFK 454 LL EGSD+VF +A EK HA KLVL A S +FR E +E +EE K E +V D+E VF+ Sbjct: 185 LLENTEGSDIVFVVAGEKFHAHKLVLAARSPIFRSEFLEKLEEGKEEIIVNDMEPKVFQ 243 >emb|CBI31240.3| unnamed protein product [Vitis vinifera] Length = 361 Score = 57.8 bits (138), Expect = 6e-06 Identities = 30/59 (50%), Positives = 41/59 (69%), Gaps = 1/59 (1%) Frame = -3 Query: 627 LLPYQEGSDVVF*IASEKLHARKLVLDA*SLVFRDELMEGMEEDKCE-VVEDLESNVFK 454 LL +EGSDV+F ++ EK HA KLVL A S +F E + G E+DK E VV+D++ +FK Sbjct: 148 LLENEEGSDVIFDVSGEKFHAHKLVLAARSPIFESEFINGPEDDKQEIVVKDMDPKIFK 206 >ref|XP_006362728.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like [Solanum tuberosum] Length = 405 Score = 57.8 bits (138), Expect = 6e-06 Identities = 35/59 (59%), Positives = 39/59 (66%), Gaps = 1/59 (1%) Frame = -3 Query: 627 LLPYQEGSDVVF*IASEKLHARKLVLDA*SLVFRDELMEGMEEDKCE-VVEDLESNVFK 454 LL EGSDVVF +A EK HA KLVL A S VFR EL + + DK E VV D+E VFK Sbjct: 193 LLENMEGSDVVFIVAGEKFHAHKLVLTARSPVFRTELFDELMGDKQEIVVTDMEPRVFK 251