BLASTX nr result
ID: Papaver31_contig00016358
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00016358 (430 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010650876.1| PREDICTED: pentatricopeptide repeat-containi... 77 5e-12 emb|CBI15914.3| unnamed protein product [Vitis vinifera] 77 5e-12 ref|XP_002278434.1| PREDICTED: pentatricopeptide repeat-containi... 77 5e-12 ref|XP_010257083.1| PREDICTED: pentatricopeptide repeat-containi... 73 9e-11 ref|XP_008221415.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 ref|XP_002521193.1| conserved hypothetical protein [Ricinus comm... 72 2e-10 ref|XP_007205048.1| hypothetical protein PRUPE_ppa004609mg [Prun... 72 2e-10 ref|XP_003568652.1| PREDICTED: pentatricopeptide repeat-containi... 70 6e-10 ref|XP_009406922.1| PREDICTED: pentatricopeptide repeat-containi... 70 8e-10 ref|XP_002313976.1| ubiquitin family protein [Populus trichocarp... 69 1e-09 emb|CDP09228.1| unnamed protein product [Coffea canephora] 69 1e-09 ref|XP_010937911.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 ref|XP_008789157.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 gb|KDO66971.1| hypothetical protein CISIN_1g010739mg [Citrus sin... 69 2e-09 ref|XP_006488563.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 ref|XP_006425116.1| hypothetical protein CICLE_v10028251mg [Citr... 69 2e-09 ref|XP_011003716.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-09 ref|XP_011461469.1| PREDICTED: pentatricopeptide repeat-containi... 66 9e-09 ref|XP_009369582.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-08 ref|XP_008349550.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-08 >ref|XP_010650876.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30100, chloroplastic isoform X2 [Vitis vinifera] Length = 511 Score = 77.0 bits (188), Expect = 5e-12 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -1 Query: 430 DAYETLVKMLDMGLCPEYLDRAAVLQGLRKGIQQTGNYESYLKL 299 DA ET++KMLD+GLCPEYLDRAAVLQGLR IQQTGN E+YLKL Sbjct: 438 DASETIIKMLDLGLCPEYLDRAAVLQGLRNRIQQTGNVETYLKL 481 >emb|CBI15914.3| unnamed protein product [Vitis vinifera] Length = 411 Score = 77.0 bits (188), Expect = 5e-12 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -1 Query: 430 DAYETLVKMLDMGLCPEYLDRAAVLQGLRKGIQQTGNYESYLKL 299 DA ET++KMLD+GLCPEYLDRAAVLQGLR IQQTGN E+YLKL Sbjct: 295 DASETIIKMLDLGLCPEYLDRAAVLQGLRNRIQQTGNVETYLKL 338 >ref|XP_002278434.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30100, chloroplastic isoform X1 [Vitis vinifera] Length = 511 Score = 77.0 bits (188), Expect = 5e-12 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -1 Query: 430 DAYETLVKMLDMGLCPEYLDRAAVLQGLRKGIQQTGNYESYLKL 299 DA ET++KMLD+GLCPEYLDRAAVLQGLR IQQTGN E+YLKL Sbjct: 438 DASETIIKMLDLGLCPEYLDRAAVLQGLRNRIQQTGNVETYLKL 481 >ref|XP_010257083.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30100, chloroplastic [Nelumbo nucifera] Length = 511 Score = 72.8 bits (177), Expect = 9e-11 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = -1 Query: 430 DAYETLVKMLDMGLCPEYLDRAAVLQGLRKGIQQTGNYESYLKLMLC 290 DA ET++KML+ L PEYLDRAAVLQGLRKGIQQ+GN E YLKL C Sbjct: 438 DASETIIKMLNFNLYPEYLDRAAVLQGLRKGIQQSGNIEPYLKLCKC 484 >ref|XP_008221415.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30100, chloroplastic [Prunus mume] Length = 500 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/44 (72%), Positives = 40/44 (90%) Frame = -1 Query: 430 DAYETLVKMLDMGLCPEYLDRAAVLQGLRKGIQQTGNYESYLKL 299 DA ET++KMLD+GLCPE+LDRAAVLQGLRK IQ++G ++YLKL Sbjct: 427 DAAETVIKMLDLGLCPEFLDRAAVLQGLRKSIQESGGVDTYLKL 470 >ref|XP_002521193.1| conserved hypothetical protein [Ricinus communis] gi|223539607|gb|EEF41193.1| conserved hypothetical protein [Ricinus communis] Length = 499 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/44 (79%), Positives = 37/44 (84%) Frame = -1 Query: 430 DAYETLVKMLDMGLCPEYLDRAAVLQGLRKGIQQTGNYESYLKL 299 +A E LVKMLDMGLCP+YLDR AVLQGLRK IQQ GN ESYL L Sbjct: 426 EAAEALVKMLDMGLCPDYLDRVAVLQGLRKRIQQWGNVESYLNL 469 >ref|XP_007205048.1| hypothetical protein PRUPE_ppa004609mg [Prunus persica] gi|462400690|gb|EMJ06247.1| hypothetical protein PRUPE_ppa004609mg [Prunus persica] Length = 500 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/44 (72%), Positives = 40/44 (90%) Frame = -1 Query: 430 DAYETLVKMLDMGLCPEYLDRAAVLQGLRKGIQQTGNYESYLKL 299 DA ET++KMLD+GLCPE+LDRAAVLQGLRK IQ++G ++YLKL Sbjct: 427 DAAETVIKMLDLGLCPEFLDRAAVLQGLRKSIQESGGVDTYLKL 470 >ref|XP_003568652.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30100, chloroplastic [Brachypodium distachyon] gi|944071315|gb|KQK06799.1| hypothetical protein BRADI_2g29350 [Brachypodium distachyon] Length = 472 Score = 70.1 bits (170), Expect = 6e-10 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = -1 Query: 430 DAYETLVKMLDMGLCPEYLDRAAVLQGLRKGIQQTGNYESYLKL 299 DA ETL++MLD+GLCPEYLDRAAVL L++ IQQ+GN ESY+KL Sbjct: 399 DASETLMRMLDLGLCPEYLDRAAVLTALQRNIQQSGNLESYMKL 442 >ref|XP_009406922.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30100, chloroplastic [Musa acuminata subsp. malaccensis] Length = 507 Score = 69.7 bits (169), Expect = 8e-10 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = -1 Query: 430 DAYETLVKMLDMGLCPEYLDRAAVLQGLRKGIQQTGNYESYLKL 299 DA ETL+KML++G+ PEYLDRAAVLQGLRK IQ++GN E Y+KL Sbjct: 434 DASETLIKMLNLGISPEYLDRAAVLQGLRKNIQESGNIEPYIKL 477 >ref|XP_002313976.1| ubiquitin family protein [Populus trichocarpa] gi|222850384|gb|EEE87931.1| ubiquitin family protein [Populus trichocarpa] Length = 500 Score = 69.3 bits (168), Expect = 1e-09 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = -1 Query: 430 DAYETLVKMLDMGLCPEYLDRAAVLQGLRKGIQQTGNYESYLKL 299 +A ETL+KMLD+GL P+YLDR AV+QGLRK IQQ GN ESYLKL Sbjct: 427 EAAETLIKMLDLGLSPDYLDRVAVMQGLRKRIQQWGNVESYLKL 470 >emb|CDP09228.1| unnamed protein product [Coffea canephora] Length = 367 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = -1 Query: 430 DAYETLVKMLDMGLCPEYLDRAAVLQGLRKGIQQTGNYESYLKL 299 DA ET++KMLD+GLCPE+LDRAAVLQGLR+ IQQ+ E+YLKL Sbjct: 294 DAAETVIKMLDLGLCPEFLDRAAVLQGLRRRIQQSETLETYLKL 337 >ref|XP_010937911.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30100, chloroplastic [Elaeis guineensis] Length = 510 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -1 Query: 430 DAYETLVKMLDMGLCPEYLDRAAVLQGLRKGIQQTGNYESYLKL 299 DA ETL++MLD+GL PEY+DRAAVLQGLR+ IQ++GN E Y+KL Sbjct: 437 DASETLIQMLDLGLWPEYIDRAAVLQGLRRSIQESGNIEPYIKL 480 >ref|XP_008789157.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30100, chloroplastic [Phoenix dactylifera] gi|672131199|ref|XP_008789158.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30100, chloroplastic [Phoenix dactylifera] Length = 512 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -1 Query: 430 DAYETLVKMLDMGLCPEYLDRAAVLQGLRKGIQQTGNYESYLKL 299 DA ETL++MLD+GL PEY+DRAAVLQGLR+ IQ++GN E Y+KL Sbjct: 439 DASETLIQMLDLGLWPEYIDRAAVLQGLRRSIQESGNIEPYIKL 482 >gb|KDO66971.1| hypothetical protein CISIN_1g010739mg [Citrus sinensis] Length = 502 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = -1 Query: 430 DAYETLVKMLDMGLCPEYLDRAAVLQGLRKGIQQTGNYESYLKL 299 DA ETL KMLD+GL PEY+DR AVLQGLRK IQQ+GN E+YL L Sbjct: 429 DAAETLTKMLDLGLYPEYMDRVAVLQGLRKRIQQSGNVEAYLNL 472 >ref|XP_006488563.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30100, chloroplastic-like [Citrus sinensis] Length = 502 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = -1 Query: 430 DAYETLVKMLDMGLCPEYLDRAAVLQGLRKGIQQTGNYESYLKL 299 DA ETL KMLD+GL PEY+DR AVLQGLRK IQQ+GN E+YL L Sbjct: 429 DAAETLTKMLDLGLYPEYMDRVAVLQGLRKRIQQSGNVEAYLNL 472 >ref|XP_006425116.1| hypothetical protein CICLE_v10028251mg [Citrus clementina] gi|557527050|gb|ESR38356.1| hypothetical protein CICLE_v10028251mg [Citrus clementina] Length = 502 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = -1 Query: 430 DAYETLVKMLDMGLCPEYLDRAAVLQGLRKGIQQTGNYESYLKL 299 DA ETL KMLD+GL PEY+DR AVLQGLRK IQQ+GN E+YL L Sbjct: 429 DAAETLTKMLDLGLYPEYMDRVAVLQGLRKRIQQSGNVEAYLNL 472 >ref|XP_011003716.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30100, chloroplastic [Populus euphratica] gi|743795974|ref|XP_011003735.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30100, chloroplastic [Populus euphratica] Length = 500 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = -1 Query: 430 DAYETLVKMLDMGLCPEYLDRAAVLQGLRKGIQQTGNYESYLKL 299 +A ETL+KMLD+GL P+YLDR AV+QGLRK I Q GN ESYLKL Sbjct: 427 EAAETLIKMLDLGLSPDYLDRVAVMQGLRKRIHQWGNVESYLKL 470 >ref|XP_011461469.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30100, chloroplastic [Fragaria vesca subsp. vesca] gi|764562478|ref|XP_011461470.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30100, chloroplastic [Fragaria vesca subsp. vesca] Length = 494 Score = 66.2 bits (160), Expect = 9e-09 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = -1 Query: 430 DAYETLVKMLDMGLCPEYLDRAAVLQGLRKGIQQTGNYESYLKL 299 DA ET++KMLD+GL P+YLDRAAVL GLRK IQQ+G ++YLKL Sbjct: 421 DAAETVIKMLDLGLFPDYLDRAAVLHGLRKRIQQSGTVDTYLKL 464 >ref|XP_009369582.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30100, chloroplastic-like [Pyrus x bretschneideri] Length = 500 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -1 Query: 430 DAYETLVKMLDMGLCPEYLDRAAVLQGLRKGIQQTGNYESYLKL 299 DA ET++KMLD+GL PE+LDRAAVLQGL+K IQQ+G ++YLKL Sbjct: 427 DAAETVIKMLDLGLHPEFLDRAAVLQGLQKRIQQSGGVDTYLKL 470 >ref|XP_008349550.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30100, chloroplastic-like [Malus domestica] Length = 500 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -1 Query: 430 DAYETLVKMLDMGLCPEYLDRAAVLQGLRKGIQQTGNYESYLKL 299 DA ET++KMLD+GL PE+LDRAAVLQGL+K IQQ+G ++YLKL Sbjct: 427 DAAETVIKMLDLGLHPEFLDRAAVLQGLQKRIQQSGGVDTYLKL 470