BLASTX nr result
ID: Papaver31_contig00016011
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00016011 (1225 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AIU49357.1| galactose mutarotase-like superfamily protein, pa... 52 2e-06 ref|XP_010926025.1| PREDICTED: putative glucose-6-phosphate 1-ep... 54 3e-06 ref|XP_010926027.1| PREDICTED: putative glucose-6-phosphate 1-ep... 54 3e-06 ref|XP_010926035.1| PREDICTED: putative glucose-6-phosphate 1-ep... 54 3e-06 >gb|AIU49357.1| galactose mutarotase-like superfamily protein, partial [Buxus sinica] Length = 214 Score = 52.0 bits (123), Expect(2) = 2e-06 Identities = 26/48 (54%), Positives = 31/48 (64%) Frame = +1 Query: 877 WSSKSRAIQQGHIDSKLLSTVLTMTNTDKKSIFFNTALRTYFRAFVTR 1020 W RA+ + +DS LST LT+TNTD K FNTAL TYF A VT+ Sbjct: 109 WDFSFRALYKVALDSDSLSTELTITNTDSKPFSFNTALHTYFHASVTK 156 Score = 29.3 bits (64), Expect(2) = 2e-06 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +3 Query: 1017 KALVNARLGCRTLNKDPD 1070 KA V GC+TLNKDPD Sbjct: 156 KAAVKGLKGCKTLNKDPD 173 >ref|XP_010926025.1| PREDICTED: putative glucose-6-phosphate 1-epimerase isoform X1 [Elaeis guineensis] Length = 316 Score = 53.5 bits (127), Expect(2) = 3e-06 Identities = 27/47 (57%), Positives = 33/47 (70%) Frame = +1 Query: 877 WSSKSRAIQQGHIDSKLLSTVLTMTNTDKKSIFFNTALRTYFRAFVT 1017 W +A+ + + SK LSTVLT+TNTDKK F+TAL TYFRA VT Sbjct: 157 WDFSFQALYKVTLHSKSLSTVLTITNTDKKPFSFSTALHTYFRASVT 203 Score = 26.9 bits (58), Expect(2) = 3e-06 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +3 Query: 1020 ALVNARLGCRTLNKDPD 1070 A V GC+TLNKDPD Sbjct: 205 ASVKGLKGCKTLNKDPD 221 >ref|XP_010926027.1| PREDICTED: putative glucose-6-phosphate 1-epimerase isoform X2 [Elaeis guineensis] Length = 313 Score = 53.5 bits (127), Expect(2) = 3e-06 Identities = 27/47 (57%), Positives = 33/47 (70%) Frame = +1 Query: 877 WSSKSRAIQQGHIDSKLLSTVLTMTNTDKKSIFFNTALRTYFRAFVT 1017 W +A+ + + SK LSTVLT+TNTDKK F+TAL TYFRA VT Sbjct: 154 WDFSFQALYKVTLHSKSLSTVLTITNTDKKPFSFSTALHTYFRASVT 200 Score = 26.9 bits (58), Expect(2) = 3e-06 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +3 Query: 1020 ALVNARLGCRTLNKDPD 1070 A V GC+TLNKDPD Sbjct: 202 ASVKGLKGCKTLNKDPD 218 >ref|XP_010926035.1| PREDICTED: putative glucose-6-phosphate 1-epimerase isoform X3 [Elaeis guineensis] Length = 284 Score = 53.5 bits (127), Expect(2) = 3e-06 Identities = 27/47 (57%), Positives = 33/47 (70%) Frame = +1 Query: 877 WSSKSRAIQQGHIDSKLLSTVLTMTNTDKKSIFFNTALRTYFRAFVT 1017 W +A+ + + SK LSTVLT+TNTDKK F+TAL TYFRA VT Sbjct: 125 WDFSFQALYKVTLHSKSLSTVLTITNTDKKPFSFSTALHTYFRASVT 171 Score = 26.9 bits (58), Expect(2) = 3e-06 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +3 Query: 1020 ALVNARLGCRTLNKDPD 1070 A V GC+TLNKDPD Sbjct: 173 ASVKGLKGCKTLNKDPD 189