BLASTX nr result
ID: Papaver31_contig00014583
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00014583 (570 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010674472.1| PREDICTED: hydrophobic protein RCI2B [Beta v... 103 6e-20 ref|NP_187239.1| Hydrophobic protein RCI2A [Arabidopsis thaliana... 102 1e-19 gb|AFK81273.1| rare cold-inducible protein 2A [Camelina sativa] ... 102 1e-19 ref|XP_009134854.1| PREDICTED: hydrophobic protein RCI2A-like [B... 100 4e-19 ref|XP_006408015.1| hypothetical protein EUTSA_v10021802mg [Eutr... 100 4e-19 gb|AAF26091.1|AC012393_17 low temperature and salt responsive pr... 100 5e-19 ref|NP_187240.1| Hydrophobic protein RCI2B [Arabidopsis thaliana... 100 5e-19 gb|AFC41201.1| PM-YC3.6-Lti6b [Binary expression vector PM-YC3.6... 100 5e-19 ref|XP_002884539.1| low temperature and salt responsive protein ... 100 5e-19 ref|XP_013622833.1| PREDICTED: hydrophobic protein RCI2A [Brassi... 100 8e-19 gb|AFI47457.1| low temperature and salt responsive protein [Medi... 100 8e-19 ref|XP_009124957.1| PREDICTED: hydrophobic protein RCI2B-like [B... 99 1e-18 ref|XP_009123629.1| PREDICTED: hydrophobic protein RCI2A [Brassi... 99 1e-18 ref|XP_004494505.1| PREDICTED: hydrophobic protein LTI6B [Cicer ... 99 1e-18 ref|XP_006298933.1| hypothetical protein CARUB_v10015055mg [Caps... 99 1e-18 gb|AFK38849.1| unknown [Lotus japonicus] gi|388522485|gb|AFK4930... 99 1e-18 ref|XP_010694119.1| PREDICTED: hydrophobic protein LTI6A [Beta v... 99 2e-18 ref|XP_008246327.1| PREDICTED: hydrophobic protein RCI2B [Prunus... 99 2e-18 ref|XP_003626132.1| low temperature and salt responsive family p... 99 2e-18 ref|XP_006408016.1| hypothetical protein EUTSA_v10021895mg [Eutr... 99 2e-18 >ref|XP_010674472.1| PREDICTED: hydrophobic protein RCI2B [Beta vulgaris subsp. vulgaris] gi|731327338|ref|XP_010674473.1| PREDICTED: hydrophobic protein RCI2B [Beta vulgaris subsp. vulgaris] gi|870862925|gb|KMT14113.1| hypothetical protein BVRB_4g079350 [Beta vulgaris subsp. vulgaris] Length = 54 Score = 103 bits (257), Expect = 6e-20 Identities = 48/54 (88%), Positives = 53/54 (98%) Frame = +2 Query: 299 MSTATFVDIILAIILPPLGVFLRFGCQVEFWICLVLTFLGYLPGIIYAIFVITK 460 MSTATF+DIILAIILPPLGVFL++GC+VEFWICLVLT LGYLPGIIYAI+VITK Sbjct: 1 MSTATFIDIILAIILPPLGVFLKYGCKVEFWICLVLTLLGYLPGIIYAIWVITK 54 >ref|NP_187239.1| Hydrophobic protein RCI2A [Arabidopsis thaliana] gi|15214251|sp|Q9ZNQ7.1|RCI2A_ARATH RecName: Full=Hydrophobic protein RCI2A; AltName: Full=Low temperature and salt-responsive protein LTI6A gi|6714401|gb|AAF26090.1|AC012393_16 low temperature and salt responsive protein LTI6A [Arabidopsis thaliana] gi|13957674|gb|AAK50619.1|AF264749_2 hydrophobic protein RCI2A [Arabidopsis thaliana] gi|4039153|gb|AAC97512.1| low temperature and salt responsive protein LTI6A [Arabidopsis thaliana] gi|4325217|gb|AAD17302.1| hydrophobic protein [Arabidopsis thaliana] gi|14335130|gb|AAK59845.1| AT3g05880/F10A16_18 [Arabidopsis thaliana] gi|14532470|gb|AAK63963.1| AT3g05880/F10A16_18 [Arabidopsis thaliana] gi|18655345|gb|AAL76128.1| AT3g05880/F10A16_18 [Arabidopsis thaliana] gi|332640790|gb|AEE74311.1| Hydrophobic protein RCI2A [Arabidopsis thaliana] Length = 54 Score = 102 bits (255), Expect = 1e-19 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = +2 Query: 299 MSTATFVDIILAIILPPLGVFLRFGCQVEFWICLVLTFLGYLPGIIYAIFVITK 460 MSTATFVDII+AI+LPPLGVFLRFGC VEFWICLVLT LGY+PGIIYAI+V+TK Sbjct: 1 MSTATFVDIIIAILLPPLGVFLRFGCGVEFWICLVLTLLGYIPGIIYAIYVLTK 54 >gb|AFK81273.1| rare cold-inducible protein 2A [Camelina sativa] gi|388893090|gb|AFK81275.1| rare cold-inducible protein 2A [Camelina sativa] Length = 54 Score = 102 bits (254), Expect = 1e-19 Identities = 46/54 (85%), Positives = 52/54 (96%) Frame = +2 Query: 299 MSTATFVDIILAIILPPLGVFLRFGCQVEFWICLVLTFLGYLPGIIYAIFVITK 460 MSTATFVDII+A++LPPLGVFLRFGC VEFWICLVLT LGY+PGIIYAI+V+TK Sbjct: 1 MSTATFVDIIIAVLLPPLGVFLRFGCGVEFWICLVLTLLGYIPGIIYAIYVLTK 54 >ref|XP_009134854.1| PREDICTED: hydrophobic protein RCI2A-like [Brassica rapa] gi|685287819|ref|XP_009134855.1| PREDICTED: hydrophobic protein RCI2A-like [Brassica rapa] gi|923548917|ref|XP_013735929.1| PREDICTED: hydrophobic protein RCI2A-like [Brassica napus] gi|923548920|ref|XP_013735930.1| PREDICTED: hydrophobic protein RCI2A-like [Brassica napus] Length = 54 Score = 100 bits (250), Expect = 4e-19 Identities = 45/54 (83%), Positives = 51/54 (94%) Frame = +2 Query: 299 MSTATFVDIILAIILPPLGVFLRFGCQVEFWICLVLTFLGYLPGIIYAIFVITK 460 M TATF+DI+LAI+LPPLGVFLR+GC VEFWICLVLT LGYLPGIIYA+FV+TK Sbjct: 1 MGTATFIDILLAILLPPLGVFLRYGCGVEFWICLVLTLLGYLPGIIYALFVLTK 54 >ref|XP_006408015.1| hypothetical protein EUTSA_v10021802mg [Eutrema salsugineum] gi|557109161|gb|ESQ49468.1| hypothetical protein EUTSA_v10021802mg [Eutrema salsugineum] Length = 111 Score = 100 bits (250), Expect = 4e-19 Identities = 53/96 (55%), Positives = 66/96 (68%), Gaps = 7/96 (7%) Frame = +2 Query: 194 CSVSLQITNTQSSTASSP-------LNFLDKILLE**LKFTNMSTATFVDIILAIILPPL 352 C S+ +T +++ S L F KI L+ M TATFV+IILAIILPPL Sbjct: 17 CLWSMDLTRERTAGPKSSRAVILYNLVFKHKIFLQ--YSSLKMGTATFVEIILAIILPPL 74 Query: 353 GVFLRFGCQVEFWICLVLTFLGYLPGIIYAIFVITK 460 GVFL+FGC++EFWICL+LT LGYLPGIIYA++ ITK Sbjct: 75 GVFLKFGCKIEFWICLILTLLGYLPGIIYALYAITK 110 >gb|AAF26091.1|AC012393_17 low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] Length = 67 Score = 100 bits (249), Expect = 5e-19 Identities = 44/54 (81%), Positives = 52/54 (96%) Frame = +2 Query: 299 MSTATFVDIILAIILPPLGVFLRFGCQVEFWICLVLTFLGYLPGIIYAIFVITK 460 MSTATFV+IILAIILPPLGVFL+FGC+VEFWICL+LT GYLPGI+YA+++ITK Sbjct: 1 MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >ref|NP_187240.1| Hydrophobic protein RCI2B [Arabidopsis thaliana] gi|15214252|sp|Q9ZNS6.1|RCI2B_ARATH RecName: Full=Hydrophobic protein RCI2B; AltName: Full=Low temperature and salt-responsive protein LTI6B gi|6671968|gb|AAF23227.1|AC013454_14 low temperature and salt responsive protein (LTI6B) [Arabidopsis thaliana] gi|13957673|gb|AAK50618.1|AF264749_1 hydrophobic protein RCI2B [Arabidopsis thaliana] gi|4039152|gb|AAC97511.1| low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] gi|4325219|gb|AAD17303.1| hydrophobic protein [Arabidopsis thaliana] gi|21536934|gb|AAM61275.1| hydrophobic protein RCI2B (Low temperature and salt responsive protein LTI6B) [Arabidopsis thaliana] gi|51970648|dbj|BAD44016.1| low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] gi|109134195|gb|ABG25095.1| At3g05890 [Arabidopsis thaliana] gi|110737346|dbj|BAF00618.1| low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] gi|332640791|gb|AEE74312.1| Hydrophobic protein RCI2B [Arabidopsis thaliana] Length = 54 Score = 100 bits (249), Expect = 5e-19 Identities = 44/54 (81%), Positives = 52/54 (96%) Frame = +2 Query: 299 MSTATFVDIILAIILPPLGVFLRFGCQVEFWICLVLTFLGYLPGIIYAIFVITK 460 MSTATFV+IILAIILPPLGVFL+FGC+VEFWICL+LT GYLPGI+YA+++ITK Sbjct: 1 MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >gb|AFC41201.1| PM-YC3.6-Lti6b [Binary expression vector PM-YC3.6-LTI6b] Length = 726 Score = 100 bits (249), Expect = 5e-19 Identities = 44/54 (81%), Positives = 52/54 (96%) Frame = +2 Query: 299 MSTATFVDIILAIILPPLGVFLRFGCQVEFWICLVLTFLGYLPGIIYAIFVITK 460 MSTATFV+IILAIILPPLGVFL+FGC+VEFWICL+LT GYLPGI+YA+++ITK Sbjct: 673 MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 726 >ref|XP_002884539.1| low temperature and salt responsive protein LTI6B [Arabidopsis lyrata subsp. lyrata] gi|297330379|gb|EFH60798.1| low temperature and salt responsive protein LTI6B [Arabidopsis lyrata subsp. lyrata] Length = 67 Score = 100 bits (249), Expect = 5e-19 Identities = 44/54 (81%), Positives = 52/54 (96%) Frame = +2 Query: 299 MSTATFVDIILAIILPPLGVFLRFGCQVEFWICLVLTFLGYLPGIIYAIFVITK 460 MSTATFV+IILAIILPPLGVFL+FGC+VEFWICL+LT GYLPGI+YA+++ITK Sbjct: 1 MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >ref|XP_013622833.1| PREDICTED: hydrophobic protein RCI2A [Brassica oleracea var. oleracea] gi|922433435|ref|XP_013622834.1| PREDICTED: hydrophobic protein RCI2A [Brassica oleracea var. oleracea] gi|923791639|ref|XP_013684481.1| PREDICTED: hydrophobic protein RCI2A [Brassica napus] gi|923791642|ref|XP_013684482.1| PREDICTED: hydrophobic protein RCI2A [Brassica napus] gi|923791644|ref|XP_013684483.1| PREDICTED: hydrophobic protein RCI2A [Brassica napus] gi|674882386|emb|CDY49984.1| BnaC03g34410D [Brassica napus] Length = 54 Score = 99.8 bits (247), Expect = 8e-19 Identities = 44/54 (81%), Positives = 51/54 (94%) Frame = +2 Query: 299 MSTATFVDIILAIILPPLGVFLRFGCQVEFWICLVLTFLGYLPGIIYAIFVITK 460 M TATF+DI+LAI+LPPLGVFLR+GC VEFWICLVLT LGYLPGIIYA++V+TK Sbjct: 1 MGTATFIDILLAILLPPLGVFLRYGCGVEFWICLVLTLLGYLPGIIYALYVLTK 54 >gb|AFI47457.1| low temperature and salt responsive protein [Medicago sativa] Length = 54 Score = 99.8 bits (247), Expect = 8e-19 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = +2 Query: 299 MSTATFVDIILAIILPPLGVFLRFGCQVEFWICLVLTFLGYLPGIIYAIFVITK 460 M TAT VDIILAIILPPLGVFL+FGC VEFWICL+LT LGYLPGI+YAI+VITK Sbjct: 1 MGTATCVDIILAIILPPLGVFLKFGCNVEFWICLILTILGYLPGILYAIYVITK 54 >ref|XP_009124957.1| PREDICTED: hydrophobic protein RCI2B-like [Brassica rapa] gi|922404881|ref|XP_013624669.1| PREDICTED: hydrophobic protein RCI2B-like [Brassica oleracea var. oleracea] gi|923516244|ref|XP_013647899.1| PREDICTED: hydrophobic protein RCI2B-like [Brassica napus] gi|923911333|ref|XP_013725411.1| PREDICTED: hydrophobic protein RCI2B-like [Brassica napus] Length = 54 Score = 99.0 bits (245), Expect = 1e-18 Identities = 42/54 (77%), Positives = 51/54 (94%) Frame = +2 Query: 299 MSTATFVDIILAIILPPLGVFLRFGCQVEFWICLVLTFLGYLPGIIYAIFVITK 460 M TATF+DI+LAI+LPPLGVFLR+GC+VEFWICLVLT GYLPGI+YA++V+TK Sbjct: 1 MGTATFIDILLAILLPPLGVFLRYGCEVEFWICLVLTLFGYLPGILYALYVLTK 54 >ref|XP_009123629.1| PREDICTED: hydrophobic protein RCI2A [Brassica rapa] gi|922481306|ref|XP_013638433.1| PREDICTED: hydrophobic protein RCI2A-like [Brassica oleracea var. oleracea] gi|923817532|ref|XP_013692999.1| PREDICTED: hydrophobic protein RCI2A-like [Brassica napus] gi|674928081|emb|CDY05209.1| BnaC05g45940D [Brassica napus] Length = 54 Score = 99.0 bits (245), Expect = 1e-18 Identities = 43/54 (79%), Positives = 51/54 (94%) Frame = +2 Query: 299 MSTATFVDIILAIILPPLGVFLRFGCQVEFWICLVLTFLGYLPGIIYAIFVITK 460 M TATF+DI+LAI+LPPLGVFLR+GC VEFWICLVLT LGYLPGI+YA++V+TK Sbjct: 1 MGTATFIDILLAILLPPLGVFLRYGCGVEFWICLVLTLLGYLPGILYALYVLTK 54 >ref|XP_004494505.1| PREDICTED: hydrophobic protein LTI6B [Cicer arietinum] Length = 54 Score = 99.0 bits (245), Expect = 1e-18 Identities = 46/54 (85%), Positives = 49/54 (90%) Frame = +2 Query: 299 MSTATFVDIILAIILPPLGVFLRFGCQVEFWICLVLTFLGYLPGIIYAIFVITK 460 M TAT VDIILAIILPPLGVFL+FGC VEFWICL+LT LGYLPGIIYAI+ ITK Sbjct: 1 MGTATCVDIILAIILPPLGVFLKFGCNVEFWICLILTILGYLPGIIYAIYAITK 54 >ref|XP_006298933.1| hypothetical protein CARUB_v10015055mg [Capsella rubella] gi|482567642|gb|EOA31831.1| hypothetical protein CARUB_v10015055mg [Capsella rubella] Length = 54 Score = 99.0 bits (245), Expect = 1e-18 Identities = 42/54 (77%), Positives = 52/54 (96%) Frame = +2 Query: 299 MSTATFVDIILAIILPPLGVFLRFGCQVEFWICLVLTFLGYLPGIIYAIFVITK 460 MSTATFV+I+LAI+LPPLGVFL+FGC+VEFWICL+LT GYLPGI+YA+++ITK Sbjct: 1 MSTATFVEILLAILLPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >gb|AFK38849.1| unknown [Lotus japonicus] gi|388522485|gb|AFK49304.1| unknown [Lotus japonicus] Length = 54 Score = 99.0 bits (245), Expect = 1e-18 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = +2 Query: 299 MSTATFVDIILAIILPPLGVFLRFGCQVEFWICLVLTFLGYLPGIIYAIFVITK 460 M TAT VDIILAIILPPLGVFLRFGC+VEFWICL+LT LGY+PGIIYAI+ ITK Sbjct: 1 MGTATCVDIILAIILPPLGVFLRFGCKVEFWICLLLTILGYIPGIIYAIYAITK 54 >ref|XP_010694119.1| PREDICTED: hydrophobic protein LTI6A [Beta vulgaris subsp. vulgaris] gi|870845968|gb|KMS98602.1| hypothetical protein BVRB_3g070450 [Beta vulgaris subsp. vulgaris] Length = 56 Score = 98.6 bits (244), Expect = 2e-18 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = +2 Query: 302 STATFVDIILAIILPPLGVFLRFGCQVEFWICLVLTFLGYLPGIIYAIFVITK 460 STAT +DI+LAIILPPLGVFL+FGC+VEFWICLVLTF GYLPGIIYA++ ITK Sbjct: 4 STATCIDILLAIILPPLGVFLKFGCKVEFWICLVLTFFGYLPGIIYAVYAITK 56 >ref|XP_008246327.1| PREDICTED: hydrophobic protein RCI2B [Prunus mume] Length = 54 Score = 98.6 bits (244), Expect = 2e-18 Identities = 42/54 (77%), Positives = 50/54 (92%) Frame = +2 Query: 299 MSTATFVDIILAIILPPLGVFLRFGCQVEFWICLVLTFLGYLPGIIYAIFVITK 460 M TATFVDII+AI+LPPLGVFL+FGC+ EFWICL+LT GYLPGIIYAI+++TK Sbjct: 1 MGTATFVDIIIAILLPPLGVFLKFGCEAEFWICLILTLFGYLPGIIYAIYILTK 54 >ref|XP_003626132.1| low temperature and salt responsive family protein [Medicago truncatula] gi|87241339|gb|ABD33197.1| Protein of unknown function UPF0057 [Medicago truncatula] gi|355501147|gb|AES82350.1| low temperature and salt responsive family protein [Medicago truncatula] gi|388497498|gb|AFK36815.1| unknown [Medicago truncatula] Length = 54 Score = 98.6 bits (244), Expect = 2e-18 Identities = 45/54 (83%), Positives = 49/54 (90%) Frame = +2 Query: 299 MSTATFVDIILAIILPPLGVFLRFGCQVEFWICLVLTFLGYLPGIIYAIFVITK 460 M TAT +DIILAIILPPLGVFL+FGC VEFWICL+LT LGYLPGIIYAI+ ITK Sbjct: 1 MGTATCIDIILAIILPPLGVFLKFGCNVEFWICLILTILGYLPGIIYAIYAITK 54 >ref|XP_006408016.1| hypothetical protein EUTSA_v10021895mg [Eutrema salsugineum] gi|557109162|gb|ESQ49469.1| hypothetical protein EUTSA_v10021895mg [Eutrema salsugineum] Length = 54 Score = 98.6 bits (244), Expect = 2e-18 Identities = 43/54 (79%), Positives = 50/54 (92%) Frame = +2 Query: 299 MSTATFVDIILAIILPPLGVFLRFGCQVEFWICLVLTFLGYLPGIIYAIFVITK 460 M TATF+DI+LAI+LPPLGVFLRFGC VEFWICLVLT GYLPGI+YA++V+TK Sbjct: 1 MGTATFIDILLAILLPPLGVFLRFGCGVEFWICLVLTLFGYLPGILYALYVLTK 54