BLASTX nr result
ID: Papaver31_contig00014405
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00014405 (1037 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010261808.1| PREDICTED: endoribonuclease Dicer homolog 3a... 59 6e-06 ref|XP_010261807.1| PREDICTED: endoribonuclease Dicer homolog 3a... 59 6e-06 >ref|XP_010261808.1| PREDICTED: endoribonuclease Dicer homolog 3a isoform X2 [Nelumbo nucifera] Length = 1622 Score = 58.9 bits (141), Expect = 6e-06 Identities = 28/49 (57%), Positives = 34/49 (69%) Frame = -1 Query: 299 CLMVFGECHCTTRNHAYIVIIKEFYFYHRYANKHKIFGMTTSQVINKFV 153 CL++F ECH T NH Y+ I+KE FYH+ NK KIFGMT S V+ K V Sbjct: 150 CLVIFDECHRATGNHPYMKIMKE--FYHKSRNKPKIFGMTASPVVRKGV 196 >ref|XP_010261807.1| PREDICTED: endoribonuclease Dicer homolog 3a isoform X1 [Nelumbo nucifera] Length = 1665 Score = 58.9 bits (141), Expect = 6e-06 Identities = 28/49 (57%), Positives = 34/49 (69%) Frame = -1 Query: 299 CLMVFGECHCTTRNHAYIVIIKEFYFYHRYANKHKIFGMTTSQVINKFV 153 CL++F ECH T NH Y+ I+KE FYH+ NK KIFGMT S V+ K V Sbjct: 150 CLVIFDECHRATGNHPYMKIMKE--FYHKSRNKPKIFGMTASPVVRKGV 196