BLASTX nr result
ID: Papaver31_contig00014319
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00014319 (443 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC97433.2| cellulose synthase [Boehmeria nivea] 69 2e-09 gb|AAY78952.3| cellulose synthase CesA1 [Boehmeria nivea] 69 2e-09 ref|XP_010254360.1| PREDICTED: probable cellulose synthase A cat... 67 4e-09 ref|XP_011459196.1| PREDICTED: cellulose synthase A catalytic su... 67 5e-09 gb|KJB53893.1| hypothetical protein B456_009G010200 [Gossypium r... 67 5e-09 ref|XP_012442296.1| PREDICTED: cellulose synthase A catalytic su... 67 5e-09 gb|KHG24504.1| putative cellulose synthase A catalytic subunit 1... 67 5e-09 gb|KHG16324.1| putative cellulose synthase A catalytic subunit 1... 67 5e-09 gb|KHG11461.1| Cellulose synthase A catalytic subunit 1 [UDP-for... 67 5e-09 emb|CDP13491.1| unnamed protein product [Coffea canephora] 67 5e-09 ref|XP_004291468.1| PREDICTED: cellulose synthase A catalytic su... 67 5e-09 ref|XP_012442294.1| PREDICTED: cellulose synthase A catalytic su... 67 5e-09 gb|ACS88359.1| cellulose synthase catalytic subunit [Gossypium h... 67 5e-09 ref|XP_009597841.1| PREDICTED: cellulose synthase A catalytic su... 66 9e-09 ref|XP_010048223.1| PREDICTED: cellulose synthase A catalytic su... 66 9e-09 ref|XP_008219478.1| PREDICTED: cellulose synthase A catalytic su... 66 1e-08 gb|AGV22109.1| cellulose synthase 7 [Betula luminifera] 66 1e-08 ref|XP_002308657.1| cellulose synthase family protein [Populus t... 65 2e-08 ref|XP_007013842.1| Cellulose synthase 1 [Theobroma cacao] gi|50... 65 2e-08 ref|XP_007221583.1| hypothetical protein PRUPE_ppa000611mg [Prun... 65 2e-08 >gb|AGC97433.2| cellulose synthase [Boehmeria nivea] Length = 1082 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 443 WSILLASIFSLLWVRIDPFTSAATKAAERGQQCGINC 333 WSILLASIFSLLWVRIDPFTS ATKAA RG QCG+NC Sbjct: 1047 WSILLASIFSLLWVRIDPFTSDATKAASRG-QCGVNC 1082 >gb|AAY78952.3| cellulose synthase CesA1 [Boehmeria nivea] Length = 938 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 443 WSILLASIFSLLWVRIDPFTSAATKAAERGQQCGINC 333 WSILLASIFSLLWVRIDPFTS ATKAA RG QCG+NC Sbjct: 903 WSILLASIFSLLWVRIDPFTSDATKAASRG-QCGVNC 938 >ref|XP_010254360.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 [UDP-forming] [Nelumbo nucifera] Length = 1085 Score = 67.4 bits (163), Expect = 4e-09 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 443 WSILLASIFSLLWVRIDPFTSAATKAAERGQQCGINC 333 WSILLASIFSLLWVRIDPFTS ATKAA +G QCGINC Sbjct: 1050 WSILLASIFSLLWVRIDPFTSDATKAAAKG-QCGINC 1085 >ref|XP_011459196.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] isoform X1 [Fragaria vesca subsp. vesca] Length = 1072 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -1 Query: 443 WSILLASIFSLLWVRIDPFTSAATKAAERGQQCGINC 333 WSILLASIFSLLWVRIDPFTS ATKAA +G QCG+NC Sbjct: 1037 WSILLASIFSLLWVRIDPFTSDATKAAAKG-QCGVNC 1072 >gb|KJB53893.1| hypothetical protein B456_009G010200 [Gossypium raimondii] Length = 683 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = -1 Query: 443 WSILLASIFSLLWVRIDPFTSAATKAAERGQQCGINC 333 WSILLASIFSLLWVRIDPFTS ATKAA G QCGINC Sbjct: 648 WSILLASIFSLLWVRIDPFTSEATKAAANG-QCGINC 683 >ref|XP_012442296.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like [Gossypium raimondii] gi|763786896|gb|KJB53892.1| hypothetical protein B456_009G010200 [Gossypium raimondii] Length = 1083 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = -1 Query: 443 WSILLASIFSLLWVRIDPFTSAATKAAERGQQCGINC 333 WSILLASIFSLLWVRIDPFTS ATKAA G QCGINC Sbjct: 1048 WSILLASIFSLLWVRIDPFTSEATKAAANG-QCGINC 1083 >gb|KHG24504.1| putative cellulose synthase A catalytic subunit 1 [UDP-forming] [Gossypium arboreum] Length = 603 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = -1 Query: 443 WSILLASIFSLLWVRIDPFTSAATKAAERGQQCGINC 333 WSILLASIFSLLWVRIDPFTS ATKAA G QCGINC Sbjct: 568 WSILLASIFSLLWVRIDPFTSEATKAAANG-QCGINC 603 >gb|KHG16324.1| putative cellulose synthase A catalytic subunit 1 [UDP-forming] [Gossypium arboreum] Length = 855 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = -1 Query: 443 WSILLASIFSLLWVRIDPFTSAATKAAERGQQCGINC 333 WSILLASIFSLLWVRIDPFTS ATKAA G QCGINC Sbjct: 820 WSILLASIFSLLWVRIDPFTSEATKAAANG-QCGINC 855 >gb|KHG11461.1| Cellulose synthase A catalytic subunit 1 [UDP-forming] -like protein [Gossypium arboreum] Length = 1083 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = -1 Query: 443 WSILLASIFSLLWVRIDPFTSAATKAAERGQQCGINC 333 WSILLASIFSLLWVRIDPFTS ATKAA G QCGINC Sbjct: 1048 WSILLASIFSLLWVRIDPFTSEATKAAANG-QCGINC 1083 >emb|CDP13491.1| unnamed protein product [Coffea canephora] Length = 1082 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -1 Query: 443 WSILLASIFSLLWVRIDPFTSAATKAAERGQQCGINC 333 WSILLASIFSLLWVRIDPFTS++TKAA G QCGINC Sbjct: 1047 WSILLASIFSLLWVRIDPFTSSSTKAASNG-QCGINC 1082 >ref|XP_004291468.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] isoform X2 [Fragaria vesca subsp. vesca] Length = 1069 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -1 Query: 443 WSILLASIFSLLWVRIDPFTSAATKAAERGQQCGINC 333 WSILLASIFSLLWVRIDPFTS ATKAA +G QCG+NC Sbjct: 1034 WSILLASIFSLLWVRIDPFTSDATKAAAKG-QCGVNC 1069 >ref|XP_012442294.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] [Gossypium raimondii] gi|376315424|gb|AFB18635.1| CESA6 [Gossypium hirsutum] gi|763786886|gb|KJB53882.1| hypothetical protein B456_009G009500 [Gossypium raimondii] Length = 1083 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = -1 Query: 443 WSILLASIFSLLWVRIDPFTSAATKAAERGQQCGINC 333 WSILLASIFSLLWVRIDPFTS ATKAA G QCGINC Sbjct: 1048 WSILLASIFSLLWVRIDPFTSEATKAAANG-QCGINC 1083 >gb|ACS88359.1| cellulose synthase catalytic subunit [Gossypium hirsutum] Length = 657 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = -1 Query: 443 WSILLASIFSLLWVRIDPFTSAATKAAERGQQCGINC 333 WSILLASIFSLLWVRIDPFTS ATKAA G QCGINC Sbjct: 622 WSILLASIFSLLWVRIDPFTSEATKAAANG-QCGINC 657 >ref|XP_009597841.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like [Nicotiana tomentosiformis] Length = 1085 Score = 66.2 bits (160), Expect = 9e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -1 Query: 443 WSILLASIFSLLWVRIDPFTSAATKAAERGQQCGINC 333 WS+LLASIFSLLWVRIDPFTS ATK A RG QCG+NC Sbjct: 1050 WSVLLASIFSLLWVRIDPFTSDATKTAARG-QCGVNC 1085 >ref|XP_010048223.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like [Eucalyptus grandis] gi|629115737|gb|KCW80412.1| hypothetical protein EUGRSUZ_C01769 [Eucalyptus grandis] Length = 1082 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -1 Query: 443 WSILLASIFSLLWVRIDPFTSAATKAAERGQQCGINC 333 WSILLASIFSLLWVRIDPFTS ATKA+ +G QCGINC Sbjct: 1047 WSILLASIFSLLWVRIDPFTSDATKASAKG-QCGINC 1082 >ref|XP_008219478.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] [Prunus mume] Length = 1072 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -1 Query: 443 WSILLASIFSLLWVRIDPFTSAATKAAERGQQCGINC 333 WSILLASIFSLLWVRIDPFT+ ATKAA G QCGINC Sbjct: 1037 WSILLASIFSLLWVRIDPFTNDATKAASNG-QCGINC 1072 >gb|AGV22109.1| cellulose synthase 7 [Betula luminifera] Length = 1085 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -1 Query: 443 WSILLASIFSLLWVRIDPFTSAATKAAERGQQCGINC 333 WSILLASIFSLLWVRIDPFTSA+ KAA G QCGINC Sbjct: 1050 WSILLASIFSLLWVRIDPFTSASAKAAANG-QCGINC 1085 >ref|XP_002308657.1| cellulose synthase family protein [Populus trichocarpa] gi|222854633|gb|EEE92180.1| cellulose synthase family protein [Populus trichocarpa] Length = 1075 Score = 65.5 bits (158), Expect = 2e-08 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -1 Query: 443 WSILLASIFSLLWVRIDPFTSAATKAAERGQQCGINC 333 WSILLASIFSLLWVRIDPFTS +TKAA G QCGINC Sbjct: 1040 WSILLASIFSLLWVRIDPFTSDSTKAAANG-QCGINC 1075 >ref|XP_007013842.1| Cellulose synthase 1 [Theobroma cacao] gi|508784205|gb|EOY31461.1| Cellulose synthase 1 [Theobroma cacao] Length = 1085 Score = 65.5 bits (158), Expect = 2e-08 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -1 Query: 443 WSILLASIFSLLWVRIDPFTSAATKAAERGQQCGINC 333 WSILLASIFSLLWVRIDPFTS ATK+A G QCGINC Sbjct: 1050 WSILLASIFSLLWVRIDPFTSDATKSAANG-QCGINC 1085 >ref|XP_007221583.1| hypothetical protein PRUPE_ppa000611mg [Prunus persica] gi|462418519|gb|EMJ22782.1| hypothetical protein PRUPE_ppa000611mg [Prunus persica] Length = 1072 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -1 Query: 443 WSILLASIFSLLWVRIDPFTSAATKAAERGQQCGINC 333 WSILLASIFSLLWVRIDPFT+ ATKAA G QCG+NC Sbjct: 1037 WSILLASIFSLLWVRIDPFTNDATKAASNG-QCGVNC 1072