BLASTX nr result
ID: Papaver31_contig00012922
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00012922 (708 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010254066.1| PREDICTED: peroxisomal fatty acid beta-oxida... 58 7e-06 >ref|XP_010254066.1| PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional protein AIM1 [Nelumbo nucifera] Length = 727 Score = 57.8 bits (138), Expect = 7e-06 Identities = 27/46 (58%), Positives = 37/46 (80%) Frame = -2 Query: 224 LQSTQGNLRSLVARGKLIEDKVKKAFLILMGILTYAKVQHVDMVIE 87 ++S + NLRSLV RGKL +DK +KAF IL G+L Y++ ++VDMVIE Sbjct: 348 MKSIEANLRSLVTRGKLTQDKAEKAFSILKGVLDYSEFKNVDMVIE 393