BLASTX nr result
ID: Papaver31_contig00012793
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00012793 (601 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010258297.1| PREDICTED: pentatricopeptide repeat-containi... 105 2e-20 emb|CDP02249.1| unnamed protein product [Coffea canephora] 88 4e-15 ref|XP_002278558.1| PREDICTED: pentatricopeptide repeat-containi... 82 3e-13 emb|CBI22241.3| unnamed protein product [Vitis vinifera] 80 6e-13 ref|XP_011085856.1| PREDICTED: pentatricopeptide repeat-containi... 80 1e-12 ref|XP_012084728.1| PREDICTED: pentatricopeptide repeat-containi... 78 3e-12 ref|XP_012084727.1| PREDICTED: pentatricopeptide repeat-containi... 78 3e-12 ref|XP_012084726.1| PREDICTED: pentatricopeptide repeat-containi... 78 3e-12 ref|XP_012840466.1| PREDICTED: pentatricopeptide repeat-containi... 73 1e-10 ref|XP_008806037.1| PREDICTED: pentatricopeptide repeat-containi... 70 7e-10 ref|XP_002323869.2| pentatricopeptide repeat-containing family p... 70 1e-09 ref|XP_009763948.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 ref|XP_008230790.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 ref|XP_009610093.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 ref|XP_009376285.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 ref|XP_008461454.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-09 ref|XP_008348229.1| PREDICTED: pentatricopeptide repeat-containi... 68 4e-09 ref|XP_008379838.1| PREDICTED: pentatricopeptide repeat-containi... 68 4e-09 ref|XP_011035789.1| PREDICTED: pentatricopeptide repeat-containi... 67 6e-09 ref|XP_006431198.1| hypothetical protein CICLE_v10013587mg, part... 67 7e-09 >ref|XP_010258297.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Nelumbo nucifera] gi|720007414|ref|XP_010258298.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Nelumbo nucifera] gi|720007417|ref|XP_010258299.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Nelumbo nucifera] gi|720007421|ref|XP_010258300.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Nelumbo nucifera] Length = 1298 Score = 105 bits (262), Expect = 2e-20 Identities = 67/125 (53%), Positives = 75/125 (60%), Gaps = 3/125 (2%) Frame = -1 Query: 376 FSTNLEFQHSNEKPISYTDSSDLVNKTHT---LINPSVIVKSLSHKLSYLWENQKNDNFV 206 FSTN S EKP S D NK H L+ SVI S+ + SYLWE +K + V Sbjct: 77 FSTNQTLSCSIEKPTLL--SGDEANKAHLDLPLVRRSVIGSSVISRCSYLWE-KKGETIV 133 Query: 205 QVSSLKEILLKLSDISPESIRRFWRVSSLKPHDVHQILLGFNFDSRNFANEKKKVGFLWE 26 + SLK +LLKLSDISP SIRRFWRVS LKP DV I LGF FD E +KV LWE Sbjct: 134 E-PSLKYLLLKLSDISPASIRRFWRVSILKPEDVLDIFLGFKFDCGESVYETEKVELLWE 192 Query: 25 LFNLA 11 LF LA Sbjct: 193 LFQLA 197 >emb|CDP02249.1| unnamed protein product [Coffea canephora] Length = 1250 Score = 87.8 bits (216), Expect = 4e-15 Identities = 59/158 (37%), Positives = 84/158 (53%), Gaps = 2/158 (1%) Frame = -1 Query: 472 LHLQTQQQIK-FLHFQVCIHSQIYSIKPHSDKPFSTNLEFQHSNEKPISYTDSSDLVNKT 296 + LQ+ Q+ F +F C+ S S+ P + ++ SNE S Sbjct: 18 VRLQSLSQVSVFCYFTTCVESPELSLSP-------SLIQTNESNEGLPS----------- 59 Query: 295 HTLINPSVIVKSLSHKLSYLWENQKNDNFVQVS-SLKEILLKLSDISPESIRRFWRVSSL 119 IN I +S+ K + +W++ KN V+ SLK+ L+LS+ISPESIRRFWRVS+L Sbjct: 60 ---INFRSIARSVISKSTNIWDSNKNKGEPSVNLSLKDYFLRLSNISPESIRRFWRVSAL 116 Query: 118 KPHDVHQILLGFNFDSRNFANEKKKVGFLWELFNLASQ 5 +P DV ILLGF DS F E KK+ LW ++ A + Sbjct: 117 RPEDVLDILLGFESDSGIFDIEHKKIESLWGVYKWAGE 154 >ref|XP_002278558.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Vitis vinifera] Length = 1273 Score = 81.6 bits (200), Expect = 3e-13 Identities = 63/166 (37%), Positives = 86/166 (51%), Gaps = 5/166 (3%) Frame = -1 Query: 502 RRTQILYQSYLHLQTQQQIK--FLHFQVCIHSQIYSIKPHSDKPFSTNLEFQHSNEKPIS 329 R Q + ++LH +Q+ F H V + I +D HS++ S Sbjct: 17 RMLQSFFNAHLHKPHIKQVGSLFSHLIVSTTKSRFFISSLAD----------HSSQSSSS 66 Query: 328 YTDSSDLVNKTH---TLINPSVIVKSLSHKLSYLWENQKNDNFVQVSSLKEILLKLSDIS 158 + + + + KTH + I+ S IVKS+ + S+LWE F SSLKE LL +SDIS Sbjct: 67 SSVNEEAI-KTHVDLSAIDCSRIVKSVILRCSHLWETNSVKPF-GYSSLKEHLLGISDIS 124 Query: 157 PESIRRFWRVSSLKPHDVHQILLGFNFDSRNFANEKKKVGFLWELF 20 PE+ R+F RVS LKP DV +ILLGF F N E KV LW +F Sbjct: 125 PETTRKFRRVSELKPEDVLEILLGFQFHRENPQIESGKVESLWGIF 170 >emb|CBI22241.3| unnamed protein product [Vitis vinifera] Length = 1256 Score = 80.5 bits (197), Expect = 6e-13 Identities = 55/111 (49%), Positives = 66/111 (59%), Gaps = 7/111 (6%) Frame = -1 Query: 331 SYTDSSDLVN----KTH---TLINPSVIVKSLSHKLSYLWENQKNDNFVQVSSLKEILLK 173 S + SS VN KTH + I+ S IVKS+ + S+LWE F SSLKE LL Sbjct: 44 SQSSSSSSVNEEAIKTHVDLSAIDCSRIVKSVILRCSHLWETNSVKPF-GYSSLKEHLLG 102 Query: 172 LSDISPESIRRFWRVSSLKPHDVHQILLGFNFDSRNFANEKKKVGFLWELF 20 +SDISPE+ R+F RVS LKP DV +ILLGF F N E KV LW +F Sbjct: 103 ISDISPETTRKFRRVSELKPEDVLEILLGFQFHRENPQIESGKVESLWGIF 153 >ref|XP_011085856.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Sesamum indicum] Length = 1247 Score = 79.7 bits (195), Expect = 1e-12 Identities = 48/108 (44%), Positives = 65/108 (60%), Gaps = 3/108 (2%) Frame = -1 Query: 319 SSDLVNKTHTLINP---SVIVKSLSHKLSYLWENQKNDNFVQVSSLKEILLKLSDISPES 149 SS + TH ++ S I +++ K S+LW K + F S LK+ LL+LS+ISPE Sbjct: 40 SSSEASHTHEDLSSLRFSAIAETVITKCSHLWVTNKGEGFSSFS-LKDHLLRLSNISPEV 98 Query: 148 IRRFWRVSSLKPHDVHQILLGFNFDSRNFANEKKKVGFLWELFNLASQ 5 IRRFWRVS LKP DV ++LLGF + E +KV LW +F AS+ Sbjct: 99 IRRFWRVSVLKPQDVLEMLLGFESCRGKYEVEVRKVESLWGVFKWASE 146 >ref|XP_012084728.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280 isoform X3 [Jatropha curcas] Length = 920 Score = 78.2 bits (191), Expect = 3e-12 Identities = 53/154 (34%), Positives = 77/154 (50%), Gaps = 5/154 (3%) Frame = -1 Query: 454 QQIKFLHFQVCIHSQIYSIKPHSDKPFSTNLEFQHSNEKPISYTDSSDLVNKTH---TLI 284 +Q+ FL F I SQ + H+D S++ + NKTH + I Sbjct: 34 KQVSFLFF---IKSQFLNTASHTDLSLSSH--------------SGAHKANKTHIDLSSI 76 Query: 283 NPSVIVKSLSHKLSYLWENQKND--NFVQVSSLKEILLKLSDISPESIRRFWRVSSLKPH 110 NP+ I + K +++ N + SSLKE+LL +SD+ P RRF R+ L P Sbjct: 77 NPNGIANIIISKYRQFLNRSESERENLAKYSSLKELLLDISDVIPYETRRFRRILRLTPE 136 Query: 109 DVHQILLGFNFDSRNFANEKKKVGFLWELFNLAS 8 DV ++LLGF F+ A ++KKV LW +FN AS Sbjct: 137 DVLEMLLGFQFECEKVAIKRKKVESLWGIFNWAS 170 >ref|XP_012084727.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280 isoform X2 [Jatropha curcas] Length = 1246 Score = 78.2 bits (191), Expect = 3e-12 Identities = 53/154 (34%), Positives = 77/154 (50%), Gaps = 5/154 (3%) Frame = -1 Query: 454 QQIKFLHFQVCIHSQIYSIKPHSDKPFSTNLEFQHSNEKPISYTDSSDLVNKTH---TLI 284 +Q+ FL F I SQ + H+D S++ + NKTH + I Sbjct: 34 KQVSFLFF---IKSQFLNTASHTDLSLSSH--------------SGAHKANKTHIDLSSI 76 Query: 283 NPSVIVKSLSHKLSYLWENQKND--NFVQVSSLKEILLKLSDISPESIRRFWRVSSLKPH 110 NP+ I + K +++ N + SSLKE+LL +SD+ P RRF R+ L P Sbjct: 77 NPNGIANIIISKYRQFLNRSESERENLAKYSSLKELLLDISDVIPYETRRFRRILRLTPE 136 Query: 109 DVHQILLGFNFDSRNFANEKKKVGFLWELFNLAS 8 DV ++LLGF F+ A ++KKV LW +FN AS Sbjct: 137 DVLEMLLGFQFECEKVAIKRKKVESLWGIFNWAS 170 >ref|XP_012084726.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280 isoform X1 [Jatropha curcas] gi|643714811|gb|KDP27166.1| hypothetical protein JCGZ_19865 [Jatropha curcas] Length = 1273 Score = 78.2 bits (191), Expect = 3e-12 Identities = 53/154 (34%), Positives = 77/154 (50%), Gaps = 5/154 (3%) Frame = -1 Query: 454 QQIKFLHFQVCIHSQIYSIKPHSDKPFSTNLEFQHSNEKPISYTDSSDLVNKTH---TLI 284 +Q+ FL F I SQ + H+D S++ + NKTH + I Sbjct: 34 KQVSFLFF---IKSQFLNTASHTDLSLSSH--------------SGAHKANKTHIDLSSI 76 Query: 283 NPSVIVKSLSHKLSYLWENQKND--NFVQVSSLKEILLKLSDISPESIRRFWRVSSLKPH 110 NP+ I + K +++ N + SSLKE+LL +SD+ P RRF R+ L P Sbjct: 77 NPNGIANIIISKYRQFLNRSESERENLAKYSSLKELLLDISDVIPYETRRFRRILRLTPE 136 Query: 109 DVHQILLGFNFDSRNFANEKKKVGFLWELFNLAS 8 DV ++LLGF F+ A ++KKV LW +FN AS Sbjct: 137 DVLEMLLGFQFECEKVAIKRKKVESLWGIFNWAS 170 >ref|XP_012840466.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Erythranthe guttatus] Length = 1205 Score = 72.8 bits (177), Expect = 1e-10 Identities = 37/63 (58%), Positives = 46/63 (73%) Frame = -1 Query: 196 SLKEILLKLSDISPESIRRFWRVSSLKPHDVHQILLGFNFDSRNFANEKKKVGFLWELFN 17 SLK+ LL+LS+ISPE IRRFWRVS LKP +V +IL+GF DS + E +KV LW +F Sbjct: 74 SLKDYLLRLSNISPEIIRRFWRVSELKPQNVLEILVGFESDSGKYEVEVEKVESLWGIFK 133 Query: 16 LAS 8 AS Sbjct: 134 WAS 136 >ref|XP_008806037.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Phoenix dactylifera] Length = 1290 Score = 70.5 bits (171), Expect = 7e-10 Identities = 38/87 (43%), Positives = 55/87 (63%) Frame = -1 Query: 265 KSLSHKLSYLWENQKNDNFVQVSSLKEILLKLSDISPESIRRFWRVSSLKPHDVHQILLG 86 KS+ + S++WE K D ++ +SL+++L ++SPE+ RRFWRVS+LKP +ILLG Sbjct: 99 KSVISRCSFIWET-KVDTLMEKTSLQDLLKLYGNLSPETTRRFWRVSALKPEGFLEILLG 157 Query: 85 FNFDSRNFANEKKKVGFLWELFNLASQ 5 F D KVGFLW+LF A + Sbjct: 158 FGPDV-----NLDKVGFLWKLFRWAEK 179 >ref|XP_002323869.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550320105|gb|EEF04002.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 1255 Score = 69.7 bits (169), Expect = 1e-09 Identities = 43/111 (38%), Positives = 62/111 (55%), Gaps = 2/111 (1%) Frame = -1 Query: 331 SYTDSSDLVNKTHTLINPSVIVKSLSHKLSYLWENQ--KNDNFVQVSSLKEILLKLSDIS 158 S TD S +K + N + I S+ K S+ ++ + K NF+ +S K LL +SD+ Sbjct: 48 SLTDPSLKPHKDLSSFNFNGIAHSVISKCSHFFDKKEPKRRNFLYDASFKMPLLDISDVI 107 Query: 157 PESIRRFWRVSSLKPHDVHQILLGFNFDSRNFANEKKKVGFLWELFNLASQ 5 P RRF RV LKP DV ++LLGF F+ A + KV LWE+F A++ Sbjct: 108 PHVTRRFLRVLRLKPEDVLEMLLGFQFECERVAVKSTKVESLWEIFKCANE 158 >ref|XP_009763948.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Nicotiana sylvestris] Length = 1242 Score = 68.9 bits (167), Expect = 2e-09 Identities = 30/58 (51%), Positives = 42/58 (72%) Frame = -1 Query: 193 LKEILLKLSDISPESIRRFWRVSSLKPHDVHQILLGFNFDSRNFANEKKKVGFLWELF 20 +K+ +LS+ISP ++RRFWRV+ L PHD+ +ILLGF DS NF E KK+ LW ++ Sbjct: 81 IKDCFFRLSEISPATVRRFWRVTVLNPHDILEILLGFQNDSGNFEVEVKKIESLWGIY 138 >ref|XP_008230790.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Prunus mume] Length = 1273 Score = 68.9 bits (167), Expect = 2e-09 Identities = 51/149 (34%), Positives = 72/149 (48%), Gaps = 19/149 (12%) Frame = -1 Query: 409 IYSIKPHSDKPFST------------NLEFQHSNEKPISYTD--SSDLVNKTHTLINPSV 272 +Y+ PH KP+ N ++Q S ++Y SS +T I+ S Sbjct: 22 LYAFSPH--KPYIKQVRSCHSLFSLFNAKYQFSTTTCLAYPSFPSSSTTTNNNTQIDLSS 79 Query: 271 I-----VKSLSHKLSYLWENQKNDNFVQVSSLKEILLKLSDISPESIRRFWRVSSLKPHD 107 I +S+ + S+ E K F +SLK++LL++SDI PE RR RVS +KP D Sbjct: 80 ICCPGIAQSVISRCSHFSEKNKGKGFAN-ASLKDLLLEISDIVPEYTRRLRRVSEVKPDD 138 Query: 106 VHQILLGFNFDSRNFANEKKKVGFLWELF 20 V +LLGF F E KV LWE+F Sbjct: 139 VLGLLLGFQFQCGKVGFEASKVESLWEIF 167 >ref|XP_009610093.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Nicotiana tomentosiformis] Length = 1242 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/58 (53%), Positives = 41/58 (70%) Frame = -1 Query: 193 LKEILLKLSDISPESIRRFWRVSSLKPHDVHQILLGFNFDSRNFANEKKKVGFLWELF 20 +K+ +LS+ISP ++RRFWRV L PHDV +ILLGF DS NF E KK+ LW ++ Sbjct: 81 IKDCFFRLSEISPATVRRFWRVPLLNPHDVLEILLGFQNDSGNFEVEVKKIESLWGIY 138 >ref|XP_009376285.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Pyrus x bretschneideri] Length = 1266 Score = 68.6 bits (166), Expect = 2e-09 Identities = 41/102 (40%), Positives = 60/102 (58%), Gaps = 3/102 (2%) Frame = -1 Query: 304 NKTHTLINP---SVIVKSLSHKLSYLWENQKNDNFVQVSSLKEILLKLSDISPESIRRFW 134 NKTH ++ S I +S+ + S ++ K+ +F +SLK++LL++ D+ PE RR Sbjct: 69 NKTHIDLSSVCCSGIAQSVFSRSSQFFDKNKSRDFAN-ASLKDLLLEIYDVVPEYTRRIR 127 Query: 133 RVSSLKPHDVHQILLGFNFDSRNFANEKKKVGFLWELFNLAS 8 RVS+LKP DV +LLGF F E +KV LWE+F S Sbjct: 128 RVSALKPEDVLGLLLGFRFQCGRVGFEVRKVESLWEIFKWVS 169 >ref|XP_008461454.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Cucumis melo] Length = 1246 Score = 68.2 bits (165), Expect = 3e-09 Identities = 42/136 (30%), Positives = 71/136 (52%) Frame = -1 Query: 412 QIYSIKPHSDKPFSTNLEFQHSNEKPISYTDSSDLVNKTHTLINPSVIVKSLSHKLSYLW 233 QI+ ++ S +F S + P++ + + IN S I +SL + S L Sbjct: 11 QIHRLRCSSSLTLFIPRKFFLSVQSPVALRCRNKSTTINLSSINCSGIAQSLISRCSVLL 70 Query: 232 ENQKNDNFVQVSSLKEILLKLSDISPESIRRFWRVSSLKPHDVHQILLGFNFDSRNFANE 53 EN+ N + + +SL ++LL++SD+ PE RR R+ LKP DV ++ + F + N + Sbjct: 71 ENEGNGSTLPNASLMDLLLEISDVVPEYARRIRRIPELKPEDVLKLFIEFQSEVGNNGIQ 130 Query: 52 KKKVGFLWELFNLASQ 5 KKV LW +F A++ Sbjct: 131 VKKVECLWRIFKFANE 146 >ref|XP_008348229.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Malus domestica] Length = 1070 Score = 67.8 bits (164), Expect = 4e-09 Identities = 41/102 (40%), Positives = 58/102 (56%), Gaps = 3/102 (2%) Frame = -1 Query: 304 NKTHTLINP---SVIVKSLSHKLSYLWENQKNDNFVQVSSLKEILLKLSDISPESIRRFW 134 NKTH ++ S I +S+ + S ++ K +F +SLK++LL++ D+ PE RR Sbjct: 68 NKTHIDLSSVCFSGIAQSVFSRSSQFFDKNKGRDFAN-ASLKDLLLEIYDVVPEYARRIR 126 Query: 133 RVSSLKPHDVHQILLGFNFDSRNFANEKKKVGFLWELFNLAS 8 RVS LKP DV +LLGF F E +KV LWE+F S Sbjct: 127 RVSELKPEDVLGLLLGFRFQCGRVGFEVRKVESLWEIFKWVS 168 >ref|XP_008379838.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Malus domestica] Length = 1265 Score = 67.8 bits (164), Expect = 4e-09 Identities = 41/102 (40%), Positives = 58/102 (56%), Gaps = 3/102 (2%) Frame = -1 Query: 304 NKTHTLINP---SVIVKSLSHKLSYLWENQKNDNFVQVSSLKEILLKLSDISPESIRRFW 134 NKTH ++ S I +S+ + S ++ K +F +SLK++LL++ D+ PE RR Sbjct: 68 NKTHIDLSSVCFSGIAQSVFSRSSQFFDKNKGRDFAN-ASLKDLLLEIYDVVPEYARRIR 126 Query: 133 RVSSLKPHDVHQILLGFNFDSRNFANEKKKVGFLWELFNLAS 8 RVS LKP DV +LLGF F E +KV LWE+F S Sbjct: 127 RVSELKPEDVLGLLLGFRFQCGRVGFEVRKVESLWEIFKWVS 168 >ref|XP_011035789.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Populus euphratica] Length = 1255 Score = 67.4 bits (163), Expect = 6e-09 Identities = 42/111 (37%), Positives = 61/111 (54%), Gaps = 2/111 (1%) Frame = -1 Query: 331 SYTDSSDLVNKTHTLINPSVIVKSLSHKLSYLWENQ--KNDNFVQVSSLKEILLKLSDIS 158 S TD S +K + N + I S+ K S+ ++ + K NF+ +S K LL +SD+ Sbjct: 48 SLTDPSLKPHKDLSSFNFNGIAHSVISKCSHFFDKKEPKRHNFLNDASFKMPLLDISDVI 107 Query: 157 PESIRRFWRVSSLKPHDVHQILLGFNFDSRNFANEKKKVGFLWELFNLASQ 5 P RRF RV LKP DV ++LLGF + A + KV LWE+F A++ Sbjct: 108 PHVTRRFLRVLRLKPEDVLEMLLGFQSECERVAVKSTKVESLWEIFKCANE 158 >ref|XP_006431198.1| hypothetical protein CICLE_v10013587mg, partial [Citrus clementina] gi|557533255|gb|ESR44438.1| hypothetical protein CICLE_v10013587mg, partial [Citrus clementina] Length = 1231 Score = 67.0 bits (162), Expect = 7e-09 Identities = 47/137 (34%), Positives = 72/137 (52%), Gaps = 11/137 (8%) Frame = -1 Query: 382 KPFSTNLEFQH--------SNEKPISYTDSSDLVNKTH---TLINPSVIVKSLSHKLSYL 236 KP S+ LE QH N S + S D +TH + ++ I KS + S+L Sbjct: 4 KPISS-LEKQHIFTSDIVLKNRPKSSLSSSEDQEKETHIDLSSVSFDGIAKSGLSRSSHL 62 Query: 235 WENQKNDNFVQVSSLKEILLKLSDISPESIRRFWRVSSLKPHDVHQILLGFNFDSRNFAN 56 E +K ++ +SLK++LL +SD+ P + R+F R LKP +V +IL+GF F+ Sbjct: 63 LETEKGKSYAN-ASLKDLLLNISDVVPATARKFLRFLVLKPENVLEILVGFWFECEKVGF 121 Query: 55 EKKKVGFLWELFNLASQ 5 +KV LWE+F S+ Sbjct: 122 RPEKVETLWEIFKWGSK 138