BLASTX nr result
ID: Papaver31_contig00011408
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00011408 (833 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AIU48145.1| structural maintenance of chromosomes protein 1, ... 168 4e-39 gb|AIU48115.1| structural maintenance of chromosomes protein 1, ... 167 9e-39 gb|AIU48105.1| structural maintenance of chromosomes protein 1, ... 167 1e-38 ref|XP_007050291.1| Structural maintenance of chromosome 1 prote... 167 1e-38 ref|XP_007050290.1| Structural maintenance of chromosome 1 prote... 167 1e-38 ref|XP_007050289.1| Structural maintenance of chromosome 1 prote... 167 1e-38 gb|AKU77170.1| structural maintenance of chromosomes protein 1, ... 166 2e-38 gb|AKU77160.1| structural maintenance of chromosomes protein 1, ... 166 2e-38 gb|AKU77158.1| structural maintenance of chromosomes protein 1, ... 166 2e-38 ref|XP_012085314.1| PREDICTED: structural maintenance of chromos... 166 2e-38 ref|XP_012442774.1| PREDICTED: structural maintenance of chromos... 166 3e-38 gb|KJB11325.1| hypothetical protein B456_001G253800 [Gossypium r... 166 3e-38 gb|AIU48130.1| structural maintenance of chromosomes protein 1, ... 166 3e-38 gb|AIU48109.1| structural maintenance of chromosomes protein 1, ... 166 3e-38 gb|KFK34708.1| hypothetical protein AALP_AA5G181300 [Arabis alpina] 166 3e-38 ref|XP_008235675.1| PREDICTED: structural maintenance of chromos... 166 3e-38 ref|XP_007201919.1| hypothetical protein PRUPE_ppa000396mg [Prun... 166 3e-38 gb|AKU77139.1| structural maintenance of chromosomes protein 1, ... 165 3e-38 gb|AIU48144.1| structural maintenance of chromosomes protein 1, ... 165 3e-38 gb|AIU48101.1| structural maintenance of chromosomes protein 1, ... 165 3e-38 >gb|AIU48145.1| structural maintenance of chromosomes protein 1, partial [Platanus x acerifolia] Length = 1159 Score = 168 bits (426), Expect = 4e-39 Identities = 83/92 (90%), Positives = 86/92 (93%) Frame = -3 Query: 558 LLVSWRYELFTEAFNHISSNIDKIYKQLTKSSTHQLGGTAYLNLENEDDPFLHGIKYTAM 379 LL RYELF EAFNHIS+NIDKIYKQLTKS+TH LGGTAYLNLENEDDPFLHGIKYTAM Sbjct: 986 LLKQRRYELFMEAFNHISTNIDKIYKQLTKSNTHPLGGTAYLNLENEDDPFLHGIKYTAM 1045 Query: 378 PPTKRFRDMEQLSGGEKTVAALALLFSIHIWK 283 PPTKRFRDMEQLSGGEKTVAALALLFSIH +K Sbjct: 1046 PPTKRFRDMEQLSGGEKTVAALALLFSIHSYK 1077 >gb|AIU48115.1| structural maintenance of chromosomes protein 1, partial [Buxus sinica] Length = 1162 Score = 167 bits (423), Expect = 9e-39 Identities = 81/87 (93%), Positives = 84/87 (96%) Frame = -3 Query: 543 RYELFTEAFNHISSNIDKIYKQLTKSSTHQLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 364 RYELF EAFNHIS+NIDKIYKQLTKSSTH LGGTAYLNLENEDDPFLHGIKYTAMPPTKR Sbjct: 994 RYELFMEAFNHISNNIDKIYKQLTKSSTHPLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 1053 Query: 363 FRDMEQLSGGEKTVAALALLFSIHIWK 283 FRDMEQLSGGEKTVAALALLFSIH ++ Sbjct: 1054 FRDMEQLSGGEKTVAALALLFSIHSYR 1080 >gb|AIU48105.1| structural maintenance of chromosomes protein 1, partial [Theobroma cacao] Length = 1060 Score = 167 bits (422), Expect = 1e-38 Identities = 81/87 (93%), Positives = 83/87 (95%) Frame = -3 Query: 543 RYELFTEAFNHISSNIDKIYKQLTKSSTHQLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 364 RYELF EAFNHISSNID+IYKQLTKS TH LGGTAYLNLENEDDPFLHGIKYTAMPPTKR Sbjct: 892 RYELFMEAFNHISSNIDRIYKQLTKSGTHPLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 951 Query: 363 FRDMEQLSGGEKTVAALALLFSIHIWK 283 FRDMEQLSGGEKTVAALALLFSIH +K Sbjct: 952 FRDMEQLSGGEKTVAALALLFSIHSYK 978 >ref|XP_007050291.1| Structural maintenance of chromosome 1 protein, putative isoform 3 [Theobroma cacao] gi|508702552|gb|EOX94448.1| Structural maintenance of chromosome 1 protein, putative isoform 3 [Theobroma cacao] Length = 1015 Score = 167 bits (422), Expect = 1e-38 Identities = 81/87 (93%), Positives = 83/87 (95%) Frame = -3 Query: 543 RYELFTEAFNHISSNIDKIYKQLTKSSTHQLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 364 RYELF EAFNHISSNID+IYKQLTKS TH LGGTAYLNLENEDDPFLHGIKYTAMPPTKR Sbjct: 840 RYELFMEAFNHISSNIDRIYKQLTKSGTHPLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 899 Query: 363 FRDMEQLSGGEKTVAALALLFSIHIWK 283 FRDMEQLSGGEKTVAALALLFSIH +K Sbjct: 900 FRDMEQLSGGEKTVAALALLFSIHSYK 926 >ref|XP_007050290.1| Structural maintenance of chromosome 1 protein, putative isoform 2 [Theobroma cacao] gi|508702551|gb|EOX94447.1| Structural maintenance of chromosome 1 protein, putative isoform 2 [Theobroma cacao] Length = 1217 Score = 167 bits (422), Expect = 1e-38 Identities = 81/87 (93%), Positives = 83/87 (95%) Frame = -3 Query: 543 RYELFTEAFNHISSNIDKIYKQLTKSSTHQLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 364 RYELF EAFNHISSNID+IYKQLTKS TH LGGTAYLNLENEDDPFLHGIKYTAMPPTKR Sbjct: 1042 RYELFMEAFNHISSNIDRIYKQLTKSGTHPLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 1101 Query: 363 FRDMEQLSGGEKTVAALALLFSIHIWK 283 FRDMEQLSGGEKTVAALALLFSIH +K Sbjct: 1102 FRDMEQLSGGEKTVAALALLFSIHSYK 1128 >ref|XP_007050289.1| Structural maintenance of chromosome 1 protein, putative isoform 1 [Theobroma cacao] gi|508702550|gb|EOX94446.1| Structural maintenance of chromosome 1 protein, putative isoform 1 [Theobroma cacao] Length = 1208 Score = 167 bits (422), Expect = 1e-38 Identities = 81/87 (93%), Positives = 83/87 (95%) Frame = -3 Query: 543 RYELFTEAFNHISSNIDKIYKQLTKSSTHQLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 364 RYELF EAFNHISSNID+IYKQLTKS TH LGGTAYLNLENEDDPFLHGIKYTAMPPTKR Sbjct: 1033 RYELFMEAFNHISSNIDRIYKQLTKSGTHPLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 1092 Query: 363 FRDMEQLSGGEKTVAALALLFSIHIWK 283 FRDMEQLSGGEKTVAALALLFSIH +K Sbjct: 1093 FRDMEQLSGGEKTVAALALLFSIHSYK 1119 >gb|AKU77170.1| structural maintenance of chromosomes protein 1, partial [Nandina domestica] Length = 1060 Score = 166 bits (420), Expect = 2e-38 Identities = 80/87 (91%), Positives = 84/87 (96%) Frame = -3 Query: 543 RYELFTEAFNHISSNIDKIYKQLTKSSTHQLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 364 RYELF EAFNHISSNIDKIYKQLTKS+TH LGGTAYLNLENEDDPFLHGIKYTAMPPTKR Sbjct: 934 RYELFMEAFNHISSNIDKIYKQLTKSNTHPLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 993 Query: 363 FRDMEQLSGGEKTVAALALLFSIHIWK 283 FRDMEQLSGGEKTVAALALLF+IH ++ Sbjct: 994 FRDMEQLSGGEKTVAALALLFAIHSYR 1020 >gb|AKU77160.1| structural maintenance of chromosomes protein 1, partial [Stachyurus yunnanensis] Length = 930 Score = 166 bits (420), Expect = 2e-38 Identities = 80/87 (91%), Positives = 84/87 (96%) Frame = -3 Query: 543 RYELFTEAFNHISSNIDKIYKQLTKSSTHQLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 364 RYELF EAFNHIS+NIDKIYKQLTKS+TH LGGTAYLNLENEDDPFLHGIKYTAMPPTKR Sbjct: 800 RYELFMEAFNHISNNIDKIYKQLTKSNTHPLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 859 Query: 363 FRDMEQLSGGEKTVAALALLFSIHIWK 283 FRDMEQLSGGEKTVAALALLFSIH ++ Sbjct: 860 FRDMEQLSGGEKTVAALALLFSIHSYR 886 >gb|AKU77158.1| structural maintenance of chromosomes protein 1, partial [Morus alba] Length = 1046 Score = 166 bits (420), Expect = 2e-38 Identities = 80/87 (91%), Positives = 84/87 (96%) Frame = -3 Query: 543 RYELFTEAFNHISSNIDKIYKQLTKSSTHQLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 364 RYELF +AFNHISSNIDKIYKQLTKS+TH LGGTAYLNLENEDDPFLHGIKYTAMPPTKR Sbjct: 916 RYELFMDAFNHISSNIDKIYKQLTKSNTHPLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 975 Query: 363 FRDMEQLSGGEKTVAALALLFSIHIWK 283 FRDMEQLSGGEKTVAALALLFSIH ++ Sbjct: 976 FRDMEQLSGGEKTVAALALLFSIHSYR 1002 >ref|XP_012085314.1| PREDICTED: structural maintenance of chromosomes protein 1 [Jatropha curcas] gi|643713862|gb|KDP26527.1| hypothetical protein JCGZ_17685 [Jatropha curcas] Length = 1222 Score = 166 bits (420), Expect = 2e-38 Identities = 80/87 (91%), Positives = 84/87 (96%) Frame = -3 Query: 543 RYELFTEAFNHISSNIDKIYKQLTKSSTHQLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 364 RYELF EAFNHIS+NIDKIYKQLTKS+TH LGGTAYLNLENEDDPFLHGIKYTAMPPTKR Sbjct: 1047 RYELFMEAFNHISNNIDKIYKQLTKSNTHPLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 1106 Query: 363 FRDMEQLSGGEKTVAALALLFSIHIWK 283 FRDMEQLSGGEKTVAALALLFSIH ++ Sbjct: 1107 FRDMEQLSGGEKTVAALALLFSIHSYR 1133 >ref|XP_012442774.1| PREDICTED: structural maintenance of chromosomes protein 1 [Gossypium raimondii] Length = 1217 Score = 166 bits (419), Expect = 3e-38 Identities = 80/87 (91%), Positives = 83/87 (95%) Frame = -3 Query: 543 RYELFTEAFNHISSNIDKIYKQLTKSSTHQLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 364 RYELF +AFNHISSNID+IYKQLTKS TH LGGTAYLNLENEDDPFLHGIKYTAMPPTKR Sbjct: 1042 RYELFMDAFNHISSNIDRIYKQLTKSGTHPLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 1101 Query: 363 FRDMEQLSGGEKTVAALALLFSIHIWK 283 FRDMEQLSGGEKTVAALALLFSIH +K Sbjct: 1102 FRDMEQLSGGEKTVAALALLFSIHSYK 1128 >gb|KJB11325.1| hypothetical protein B456_001G253800 [Gossypium raimondii] Length = 1240 Score = 166 bits (419), Expect = 3e-38 Identities = 80/87 (91%), Positives = 83/87 (95%) Frame = -3 Query: 543 RYELFTEAFNHISSNIDKIYKQLTKSSTHQLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 364 RYELF +AFNHISSNID+IYKQLTKS TH LGGTAYLNLENEDDPFLHGIKYTAMPPTKR Sbjct: 1065 RYELFMDAFNHISSNIDRIYKQLTKSGTHPLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 1124 Query: 363 FRDMEQLSGGEKTVAALALLFSIHIWK 283 FRDMEQLSGGEKTVAALALLFSIH +K Sbjct: 1125 FRDMEQLSGGEKTVAALALLFSIHSYK 1151 >gb|AIU48130.1| structural maintenance of chromosomes protein 1, partial [Prunus persica] Length = 1177 Score = 166 bits (419), Expect = 3e-38 Identities = 80/87 (91%), Positives = 84/87 (96%) Frame = -3 Query: 543 RYELFTEAFNHISSNIDKIYKQLTKSSTHQLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 364 RYELF +AFNHISSNIDKIYKQLTKS+TH LGGTAYLNLENEDDPFLHGIKYTAMPPTKR Sbjct: 1009 RYELFMDAFNHISSNIDKIYKQLTKSNTHPLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 1068 Query: 363 FRDMEQLSGGEKTVAALALLFSIHIWK 283 FRDMEQLSGGEKTVAALALLFSIH ++ Sbjct: 1069 FRDMEQLSGGEKTVAALALLFSIHSFR 1095 >gb|AIU48109.1| structural maintenance of chromosomes protein 1, partial [Gossypium raimondii] Length = 1187 Score = 166 bits (419), Expect = 3e-38 Identities = 80/87 (91%), Positives = 83/87 (95%) Frame = -3 Query: 543 RYELFTEAFNHISSNIDKIYKQLTKSSTHQLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 364 RYELF +AFNHISSNID+IYKQLTKS TH LGGTAYLNLENEDDPFLHGIKYTAMPPTKR Sbjct: 1019 RYELFMDAFNHISSNIDRIYKQLTKSGTHPLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 1078 Query: 363 FRDMEQLSGGEKTVAALALLFSIHIWK 283 FRDMEQLSGGEKTVAALALLFSIH +K Sbjct: 1079 FRDMEQLSGGEKTVAALALLFSIHSYK 1105 >gb|KFK34708.1| hypothetical protein AALP_AA5G181300 [Arabis alpina] Length = 1220 Score = 166 bits (419), Expect = 3e-38 Identities = 80/87 (91%), Positives = 83/87 (95%) Frame = -3 Query: 543 RYELFTEAFNHISSNIDKIYKQLTKSSTHQLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 364 RYELF EAFNHISSNIDKIYKQLTKS+TH LGGTAYLNLENEDDPFLHGIKYT MPPTKR Sbjct: 1045 RYELFMEAFNHISSNIDKIYKQLTKSNTHPLGGTAYLNLENEDDPFLHGIKYTTMPPTKR 1104 Query: 363 FRDMEQLSGGEKTVAALALLFSIHIWK 283 FRDMEQLSGGEKTVAALALLFSIH ++ Sbjct: 1105 FRDMEQLSGGEKTVAALALLFSIHSYR 1131 >ref|XP_008235675.1| PREDICTED: structural maintenance of chromosomes protein 1 [Prunus mume] Length = 1218 Score = 166 bits (419), Expect = 3e-38 Identities = 80/87 (91%), Positives = 84/87 (96%) Frame = -3 Query: 543 RYELFTEAFNHISSNIDKIYKQLTKSSTHQLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 364 RYELF +AFNHISSNIDKIYKQLTKS+TH LGGTAYLNLENEDDPFLHGIKYTAMPPTKR Sbjct: 1043 RYELFMDAFNHISSNIDKIYKQLTKSNTHPLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 1102 Query: 363 FRDMEQLSGGEKTVAALALLFSIHIWK 283 FRDMEQLSGGEKTVAALALLFSIH ++ Sbjct: 1103 FRDMEQLSGGEKTVAALALLFSIHSFR 1129 >ref|XP_007201919.1| hypothetical protein PRUPE_ppa000396mg [Prunus persica] gi|462397319|gb|EMJ03118.1| hypothetical protein PRUPE_ppa000396mg [Prunus persica] Length = 1209 Score = 166 bits (419), Expect = 3e-38 Identities = 80/87 (91%), Positives = 84/87 (96%) Frame = -3 Query: 543 RYELFTEAFNHISSNIDKIYKQLTKSSTHQLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 364 RYELF +AFNHISSNIDKIYKQLTKS+TH LGGTAYLNLENEDDPFLHGIKYTAMPPTKR Sbjct: 1034 RYELFMDAFNHISSNIDKIYKQLTKSNTHPLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 1093 Query: 363 FRDMEQLSGGEKTVAALALLFSIHIWK 283 FRDMEQLSGGEKTVAALALLFSIH ++ Sbjct: 1094 FRDMEQLSGGEKTVAALALLFSIHSFR 1120 >gb|AKU77139.1| structural maintenance of chromosomes protein 1, partial [Diospyros kaki] Length = 1051 Score = 165 bits (418), Expect = 3e-38 Identities = 79/87 (90%), Positives = 84/87 (96%) Frame = -3 Query: 543 RYELFTEAFNHISSNIDKIYKQLTKSSTHQLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 364 RY+LF EAFNHIS NIDKIYKQLTKSSTHQLGGTAYLNL+NED+PFLHGIKYTAMPPTKR Sbjct: 921 RYDLFMEAFNHISGNIDKIYKQLTKSSTHQLGGTAYLNLDNEDEPFLHGIKYTAMPPTKR 980 Query: 363 FRDMEQLSGGEKTVAALALLFSIHIWK 283 FRDMEQLSGGEKTVAALALLFSIH ++ Sbjct: 981 FRDMEQLSGGEKTVAALALLFSIHSYR 1007 >gb|AIU48144.1| structural maintenance of chromosomes protein 1, partial [Cinnamomum camphora] Length = 1063 Score = 165 bits (418), Expect = 3e-38 Identities = 80/87 (91%), Positives = 84/87 (96%) Frame = -3 Query: 543 RYELFTEAFNHISSNIDKIYKQLTKSSTHQLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 364 RYELF +AF+HISSNIDKIYKQLTKSSTH LGGTAYLNLENEDDPFLHGIKYTAMPPTKR Sbjct: 895 RYELFMQAFDHISSNIDKIYKQLTKSSTHPLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 954 Query: 363 FRDMEQLSGGEKTVAALALLFSIHIWK 283 FRDMEQLSGGEKTVAALALLFSIH ++ Sbjct: 955 FRDMEQLSGGEKTVAALALLFSIHSYR 981 >gb|AIU48101.1| structural maintenance of chromosomes protein 1, partial [Magnolia denudata] Length = 1162 Score = 165 bits (418), Expect = 3e-38 Identities = 79/87 (90%), Positives = 85/87 (97%) Frame = -3 Query: 543 RYELFTEAFNHISSNIDKIYKQLTKSSTHQLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 364 RY+LFTEAF+HIS+NIDKIYKQLTKS+TH LGGTAYLNLENEDDPFLHGIKYTAMPPTKR Sbjct: 994 RYQLFTEAFDHISNNIDKIYKQLTKSNTHPLGGTAYLNLENEDDPFLHGIKYTAMPPTKR 1053 Query: 363 FRDMEQLSGGEKTVAALALLFSIHIWK 283 FRDMEQLSGGEKTVAALALLFSIH ++ Sbjct: 1054 FRDMEQLSGGEKTVAALALLFSIHSYR 1080