BLASTX nr result
ID: Papaver31_contig00010215
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00010215 (1157 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010106863.1| 60S ribosomal protein L3 [Morus notabilis] g... 70 3e-09 gb|KJB59457.1| hypothetical protein B456_009G255300 [Gossypium r... 70 3e-09 gb|KJB59456.1| hypothetical protein B456_009G255300 [Gossypium r... 70 3e-09 ref|XP_011092385.1| PREDICTED: 60S ribosomal protein L3-like [Se... 70 3e-09 ref|XP_011087800.1| PREDICTED: 60S ribosomal protein L3-like [Se... 70 3e-09 ref|XP_012446212.1| PREDICTED: 60S ribosomal protein L3-like [Go... 70 3e-09 ref|XP_010260991.1| PREDICTED: 60S ribosomal protein L3 [Nelumbo... 70 3e-09 ref|XP_012080722.1| PREDICTED: 60S ribosomal protein L3-1 [Jatro... 70 3e-09 ref|XP_012832897.1| PREDICTED: 60S ribosomal protein L3 [Erythra... 70 3e-09 gb|EPS60891.1| hypothetical protein M569_13909 [Genlisea aurea] 70 3e-09 ref|XP_007019549.1| Ribosomal protein 1 [Theobroma cacao] gi|508... 70 3e-09 gb|ADR71240.1| 60S ribosomal protein L3B [Hevea brasiliensis] 70 3e-09 gb|ADR71239.1| 60S ribosomal protein L3A [Hevea brasiliensis] 70 3e-09 emb|CAB65281.1| L3 Ribosomal protein [Medicago sativa subsp. x v... 70 4e-09 gb|ACJ83264.1| unknown [Medicago truncatula] 70 4e-09 ref|XP_003592084.2| 60S ribosomal protein L3B [Medicago truncatu... 70 4e-09 ref|XP_010087922.1| 60S ribosomal protein L3 [Morus notabilis] g... 69 7e-09 gb|KJB77952.1| hypothetical protein B456_012G169700 [Gossypium r... 69 7e-09 ref|XP_012459018.1| PREDICTED: 60S ribosomal protein L3-2 isofor... 69 7e-09 ref|XP_011092302.1| PREDICTED: 60S ribosomal protein L3-2 [Sesam... 69 7e-09 >ref|XP_010106863.1| 60S ribosomal protein L3 [Morus notabilis] gi|587925045|gb|EXC12323.1| 60S ribosomal protein L3 [Morus notabilis] Length = 410 Score = 70.1 bits (170), Expect = 3e-09 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = -1 Query: 251 VKAFPKDDPTKPYKLTAFLGYKACMTHIV*EVEKPGS 141 VKAFPKDDPTKP KLTAFLGYKA MTHIV EVEKPGS Sbjct: 50 VKAFPKDDPTKPCKLTAFLGYKAGMTHIVREVEKPGS 86 >gb|KJB59457.1| hypothetical protein B456_009G255300 [Gossypium raimondii] Length = 310 Score = 70.1 bits (170), Expect = 3e-09 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = -1 Query: 251 VKAFPKDDPTKPYKLTAFLGYKACMTHIV*EVEKPGS 141 VKAFPKDDPTKP KLTAFLGYKA MTHIV EVEKPGS Sbjct: 29 VKAFPKDDPTKPCKLTAFLGYKAGMTHIVREVEKPGS 65 >gb|KJB59456.1| hypothetical protein B456_009G255300 [Gossypium raimondii] Length = 336 Score = 70.1 bits (170), Expect = 3e-09 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = -1 Query: 251 VKAFPKDDPTKPYKLTAFLGYKACMTHIV*EVEKPGS 141 VKAFPKDDPTKP KLTAFLGYKA MTHIV EVEKPGS Sbjct: 29 VKAFPKDDPTKPCKLTAFLGYKAGMTHIVREVEKPGS 65 >ref|XP_011092385.1| PREDICTED: 60S ribosomal protein L3-like [Sesamum indicum] gi|747089493|ref|XP_011092386.1| PREDICTED: 60S ribosomal protein L3-like [Sesamum indicum] Length = 389 Score = 70.1 bits (170), Expect = 3e-09 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = -1 Query: 251 VKAFPKDDPTKPYKLTAFLGYKACMTHIV*EVEKPGS 141 VKAFPKDDPTKP KLTAFLGYKA MTHIV EVEKPGS Sbjct: 29 VKAFPKDDPTKPCKLTAFLGYKAGMTHIVREVEKPGS 65 >ref|XP_011087800.1| PREDICTED: 60S ribosomal protein L3-like [Sesamum indicum] gi|747081057|ref|XP_011087801.1| PREDICTED: 60S ribosomal protein L3-like [Sesamum indicum] gi|747081059|ref|XP_011087802.1| PREDICTED: 60S ribosomal protein L3-like [Sesamum indicum] Length = 389 Score = 70.1 bits (170), Expect = 3e-09 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = -1 Query: 251 VKAFPKDDPTKPYKLTAFLGYKACMTHIV*EVEKPGS 141 VKAFPKDDPTKP KLTAFLGYKA MTHIV EVEKPGS Sbjct: 29 VKAFPKDDPTKPCKLTAFLGYKAGMTHIVREVEKPGS 65 >ref|XP_012446212.1| PREDICTED: 60S ribosomal protein L3-like [Gossypium raimondii] gi|728838089|gb|KHG17532.1| 60S ribosomal L3 [Gossypium arboreum] gi|763792459|gb|KJB59455.1| hypothetical protein B456_009G255300 [Gossypium raimondii] gi|763792462|gb|KJB59458.1| hypothetical protein B456_009G255300 [Gossypium raimondii] Length = 389 Score = 70.1 bits (170), Expect = 3e-09 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = -1 Query: 251 VKAFPKDDPTKPYKLTAFLGYKACMTHIV*EVEKPGS 141 VKAFPKDDPTKP KLTAFLGYKA MTHIV EVEKPGS Sbjct: 29 VKAFPKDDPTKPCKLTAFLGYKAGMTHIVREVEKPGS 65 >ref|XP_010260991.1| PREDICTED: 60S ribosomal protein L3 [Nelumbo nucifera] Length = 389 Score = 70.1 bits (170), Expect = 3e-09 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = -1 Query: 251 VKAFPKDDPTKPYKLTAFLGYKACMTHIV*EVEKPGS 141 VKAFPKDDPTKP KLTAFLGYKA MTHIV EVEKPGS Sbjct: 29 VKAFPKDDPTKPCKLTAFLGYKAGMTHIVREVEKPGS 65 >ref|XP_012080722.1| PREDICTED: 60S ribosomal protein L3-1 [Jatropha curcas] gi|643720352|gb|KDP30749.1| hypothetical protein JCGZ_15178 [Jatropha curcas] Length = 389 Score = 70.1 bits (170), Expect = 3e-09 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = -1 Query: 251 VKAFPKDDPTKPYKLTAFLGYKACMTHIV*EVEKPGS 141 VKAFPKDDPTKP KLTAFLGYKA MTHIV EVEKPGS Sbjct: 29 VKAFPKDDPTKPCKLTAFLGYKAGMTHIVREVEKPGS 65 >ref|XP_012832897.1| PREDICTED: 60S ribosomal protein L3 [Erythranthe guttatus] gi|848930075|ref|XP_012828329.1| PREDICTED: 60S ribosomal protein L3 isoform X1 [Erythranthe guttatus] gi|848930078|ref|XP_012828330.1| PREDICTED: 60S ribosomal protein L3 isoform X2 [Erythranthe guttatus] gi|848930081|ref|XP_012828331.1| PREDICTED: 60S ribosomal protein L3 isoform X1 [Erythranthe guttatus] gi|848930092|ref|XP_012828332.1| PREDICTED: 60S ribosomal protein L3 [Erythranthe guttatus] gi|604298485|gb|EYU18529.1| hypothetical protein MIMGU_mgv1a007968mg [Erythranthe guttata] gi|604298486|gb|EYU18530.1| hypothetical protein MIMGU_mgv1a007964mg [Erythranthe guttata] gi|604298487|gb|EYU18531.1| hypothetical protein MIMGU_mgv1a007964mg [Erythranthe guttata] gi|604341927|gb|EYU41143.1| hypothetical protein MIMGU_mgv1a007980mg [Erythranthe guttata] Length = 389 Score = 70.1 bits (170), Expect = 3e-09 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = -1 Query: 251 VKAFPKDDPTKPYKLTAFLGYKACMTHIV*EVEKPGS 141 VKAFPKDDPTKP KLTAFLGYKA MTHIV EVEKPGS Sbjct: 29 VKAFPKDDPTKPCKLTAFLGYKAGMTHIVREVEKPGS 65 >gb|EPS60891.1| hypothetical protein M569_13909 [Genlisea aurea] Length = 389 Score = 70.1 bits (170), Expect = 3e-09 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = -1 Query: 251 VKAFPKDDPTKPYKLTAFLGYKACMTHIV*EVEKPGS 141 VKAFPKDDPTKP KLTAFLGYKA MTHIV EVEKPGS Sbjct: 29 VKAFPKDDPTKPCKLTAFLGYKAGMTHIVREVEKPGS 65 >ref|XP_007019549.1| Ribosomal protein 1 [Theobroma cacao] gi|508724877|gb|EOY16774.1| Ribosomal protein 1 [Theobroma cacao] Length = 389 Score = 70.1 bits (170), Expect = 3e-09 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = -1 Query: 251 VKAFPKDDPTKPYKLTAFLGYKACMTHIV*EVEKPGS 141 VKAFPKDDPTKP KLTAFLGYKA MTHIV EVEKPGS Sbjct: 29 VKAFPKDDPTKPCKLTAFLGYKAGMTHIVREVEKPGS 65 >gb|ADR71240.1| 60S ribosomal protein L3B [Hevea brasiliensis] Length = 389 Score = 70.1 bits (170), Expect = 3e-09 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = -1 Query: 251 VKAFPKDDPTKPYKLTAFLGYKACMTHIV*EVEKPGS 141 VKAFPKDDPTKP KLTAFLGYKA MTHIV EVEKPGS Sbjct: 29 VKAFPKDDPTKPCKLTAFLGYKAGMTHIVREVEKPGS 65 >gb|ADR71239.1| 60S ribosomal protein L3A [Hevea brasiliensis] Length = 389 Score = 70.1 bits (170), Expect = 3e-09 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = -1 Query: 251 VKAFPKDDPTKPYKLTAFLGYKACMTHIV*EVEKPGS 141 VKAFPKDDPTKP KLTAFLGYKA MTHIV EVEKPGS Sbjct: 29 VKAFPKDDPTKPCKLTAFLGYKAGMTHIVREVEKPGS 65 >emb|CAB65281.1| L3 Ribosomal protein [Medicago sativa subsp. x varia] Length = 388 Score = 69.7 bits (169), Expect = 4e-09 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = -1 Query: 251 VKAFPKDDPTKPYKLTAFLGYKACMTHIV*EVEKPGS 141 VKAFPKDDPTKP KLTAFLGYKA MTHIV EVEKPGS Sbjct: 29 VKAFPKDDPTKPPKLTAFLGYKAGMTHIVREVEKPGS 65 >gb|ACJ83264.1| unknown [Medicago truncatula] Length = 177 Score = 69.7 bits (169), Expect = 4e-09 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = -1 Query: 251 VKAFPKDDPTKPYKLTAFLGYKACMTHIV*EVEKPGS 141 VKAFPKDDPTKP KLTAFLGYKA MTHIV EVEKPGS Sbjct: 29 VKAFPKDDPTKPPKLTAFLGYKAGMTHIVREVEKPGS 65 >ref|XP_003592084.2| 60S ribosomal protein L3B [Medicago truncatula] gi|657405085|gb|AES62335.2| 60S ribosomal protein L3B [Medicago truncatula] Length = 389 Score = 69.7 bits (169), Expect = 4e-09 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = -1 Query: 251 VKAFPKDDPTKPYKLTAFLGYKACMTHIV*EVEKPGS 141 VKAFPKDDPTKP KLTAFLGYKA MTHIV EVEKPGS Sbjct: 29 VKAFPKDDPTKPPKLTAFLGYKAGMTHIVREVEKPGS 65 >ref|XP_010087922.1| 60S ribosomal protein L3 [Morus notabilis] gi|587840118|gb|EXB30757.1| 60S ribosomal protein L3 [Morus notabilis] Length = 389 Score = 68.9 bits (167), Expect = 7e-09 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 251 VKAFPKDDPTKPYKLTAFLGYKACMTHIV*EVEKPGS 141 VKAFPKDDPTKP +LTAFLGYKA MTHIV EVEKPGS Sbjct: 29 VKAFPKDDPTKPCRLTAFLGYKAGMTHIVREVEKPGS 65 >gb|KJB77952.1| hypothetical protein B456_012G169700 [Gossypium raimondii] Length = 304 Score = 68.9 bits (167), Expect = 7e-09 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 251 VKAFPKDDPTKPYKLTAFLGYKACMTHIV*EVEKPGS 141 VKAFPKDDPTKP +LTAFLGYKA MTHIV EVEKPGS Sbjct: 29 VKAFPKDDPTKPCRLTAFLGYKAGMTHIVREVEKPGS 65 >ref|XP_012459018.1| PREDICTED: 60S ribosomal protein L3-2 isoform X1 [Gossypium raimondii] gi|763811048|gb|KJB77950.1| hypothetical protein B456_012G169700 [Gossypium raimondii] gi|763811051|gb|KJB77953.1| hypothetical protein B456_012G169700 [Gossypium raimondii] Length = 389 Score = 68.9 bits (167), Expect = 7e-09 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 251 VKAFPKDDPTKPYKLTAFLGYKACMTHIV*EVEKPGS 141 VKAFPKDDPTKP +LTAFLGYKA MTHIV EVEKPGS Sbjct: 29 VKAFPKDDPTKPCRLTAFLGYKAGMTHIVREVEKPGS 65 >ref|XP_011092302.1| PREDICTED: 60S ribosomal protein L3-2 [Sesamum indicum] gi|747089342|ref|XP_011092303.1| PREDICTED: 60S ribosomal protein L3-2 [Sesamum indicum] Length = 389 Score = 68.9 bits (167), Expect = 7e-09 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 251 VKAFPKDDPTKPYKLTAFLGYKACMTHIV*EVEKPGS 141 VKAFPKDDPTKP +LTAFLGYKA MTHIV EVEKPGS Sbjct: 29 VKAFPKDDPTKPCRLTAFLGYKAGMTHIVREVEKPGS 65