BLASTX nr result
ID: Papaver31_contig00009062
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00009062 (422 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW69756.1| hypothetical protein EUGRSUZ_F03131 [Eucalyptus g... 65 2e-08 ref|XP_010062626.1| PREDICTED: transmembrane 9 superfamily membe... 65 2e-08 gb|KMZ73357.1| Transmembrane 9 superfamily protein member [Zoste... 65 2e-08 ref|XP_014516553.1| PREDICTED: transmembrane 9 superfamily membe... 65 3e-08 gb|KNA08197.1| hypothetical protein SOVF_164810 [Spinacia oleracea] 65 3e-08 gb|KJB68209.1| hypothetical protein B456_010G231900 [Gossypium r... 65 3e-08 ref|XP_012450126.1| PREDICTED: transmembrane 9 superfamily membe... 65 3e-08 ref|XP_012445826.1| PREDICTED: transmembrane 9 superfamily membe... 65 3e-08 ref|XP_011072512.1| PREDICTED: transmembrane 9 superfamily membe... 65 3e-08 ref|XP_011080167.1| PREDICTED: transmembrane 9 superfamily membe... 65 3e-08 ref|XP_011000794.1| PREDICTED: transmembrane 9 superfamily membe... 65 3e-08 ref|XP_010667162.1| PREDICTED: transmembrane 9 superfamily membe... 65 3e-08 ref|XP_010667161.1| PREDICTED: transmembrane 9 superfamily membe... 65 3e-08 gb|KHG26194.1| Transmembrane 9 superfamily member 4 [Gossypium a... 65 3e-08 gb|KHF99403.1| Transmembrane 9 superfamily member 4 [Gossypium a... 65 3e-08 gb|KFK35594.1| hypothetical protein AALP_AA4G011800 [Arabis alpina] 65 3e-08 emb|CDO97915.1| unnamed protein product [Coffea canephora] 65 3e-08 ref|XP_008228298.1| PREDICTED: transmembrane 9 superfamily membe... 65 3e-08 gb|KDO65261.1| hypothetical protein CISIN_1g040848mg [Citrus sin... 65 3e-08 ref|XP_012844969.1| PREDICTED: transmembrane 9 superfamily membe... 65 3e-08 >gb|KCW69756.1| hypothetical protein EUGRSUZ_F03131 [Eucalyptus grandis] Length = 502 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 147 VHSLASDIKWASRWDTYLLMNDGQIHWFSIINSL 46 V + SDIKWASRWDTYLLMND QIHWFSIINSL Sbjct: 250 VSFMESDIKWASRWDTYLLMNDDQIHWFSIINSL 283 >ref|XP_010062626.1| PREDICTED: transmembrane 9 superfamily member 4 [Eucalyptus grandis] gi|629104286|gb|KCW69755.1| hypothetical protein EUGRSUZ_F03131 [Eucalyptus grandis] Length = 638 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 147 VHSLASDIKWASRWDTYLLMNDGQIHWFSIINSL 46 V + SDIKWASRWDTYLLMND QIHWFSIINSL Sbjct: 250 VSFMESDIKWASRWDTYLLMNDDQIHWFSIINSL 283 >gb|KMZ73357.1| Transmembrane 9 superfamily protein member [Zostera marina] Length = 632 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 147 VHSLASDIKWASRWDTYLLMNDGQIHWFSIINSL 46 V + SDIKWASRWDTYLLMND QIHWFSIINSL Sbjct: 244 VSFVPSDIKWASRWDTYLLMNDDQIHWFSIINSL 277 >ref|XP_014516553.1| PREDICTED: transmembrane 9 superfamily member 7 [Vigna radiata var. radiata] Length = 640 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 132 SDIKWASRWDTYLLMNDGQIHWFSIINSL 46 SDIKWASRWDTYLLMND QIHWFSIINSL Sbjct: 257 SDIKWASRWDTYLLMNDDQIHWFSIINSL 285 >gb|KNA08197.1| hypothetical protein SOVF_164810 [Spinacia oleracea] Length = 441 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 132 SDIKWASRWDTYLLMNDGQIHWFSIINSL 46 SDIKWASRWDTYLLMND QIHWFSIINSL Sbjct: 58 SDIKWASRWDTYLLMNDDQIHWFSIINSL 86 >gb|KJB68209.1| hypothetical protein B456_010G231900 [Gossypium raimondii] Length = 530 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 132 SDIKWASRWDTYLLMNDGQIHWFSIINSL 46 SDIKWASRWDTYLLMND QIHWFSIINSL Sbjct: 147 SDIKWASRWDTYLLMNDDQIHWFSIINSL 175 >ref|XP_012450126.1| PREDICTED: transmembrane 9 superfamily member 7 [Gossypium raimondii] gi|763801253|gb|KJB68208.1| hypothetical protein B456_010G231900 [Gossypium raimondii] Length = 635 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 132 SDIKWASRWDTYLLMNDGQIHWFSIINSL 46 SDIKWASRWDTYLLMND QIHWFSIINSL Sbjct: 252 SDIKWASRWDTYLLMNDDQIHWFSIINSL 280 >ref|XP_012445826.1| PREDICTED: transmembrane 9 superfamily member 7-like [Gossypium raimondii] gi|763789903|gb|KJB56899.1| hypothetical protein B456_009G140900 [Gossypium raimondii] Length = 635 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 132 SDIKWASRWDTYLLMNDGQIHWFSIINSL 46 SDIKWASRWDTYLLMND QIHWFSIINSL Sbjct: 252 SDIKWASRWDTYLLMNDDQIHWFSIINSL 280 >ref|XP_011072512.1| PREDICTED: transmembrane 9 superfamily member 7 [Sesamum indicum] Length = 639 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 132 SDIKWASRWDTYLLMNDGQIHWFSIINSL 46 SDIKWASRWDTYLLMND QIHWFSIINSL Sbjct: 256 SDIKWASRWDTYLLMNDDQIHWFSIINSL 284 >ref|XP_011080167.1| PREDICTED: transmembrane 9 superfamily member 7-like [Sesamum indicum] Length = 639 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 132 SDIKWASRWDTYLLMNDGQIHWFSIINSL 46 SDIKWASRWDTYLLMND QIHWFSIINSL Sbjct: 256 SDIKWASRWDTYLLMNDDQIHWFSIINSL 284 >ref|XP_011000794.1| PREDICTED: transmembrane 9 superfamily member 7 [Populus euphratica] Length = 638 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 132 SDIKWASRWDTYLLMNDGQIHWFSIINSL 46 SDIKWASRWDTYLLMND QIHWFSIINSL Sbjct: 255 SDIKWASRWDTYLLMNDDQIHWFSIINSL 283 >ref|XP_010667162.1| PREDICTED: transmembrane 9 superfamily member 7-like [Beta vulgaris subsp. vulgaris] gi|870842053|gb|KMS95563.1| hypothetical protein BVRB_007090 [Beta vulgaris subsp. vulgaris] Length = 635 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 132 SDIKWASRWDTYLLMNDGQIHWFSIINSL 46 SDIKWASRWDTYLLMND QIHWFSIINSL Sbjct: 252 SDIKWASRWDTYLLMNDDQIHWFSIINSL 280 >ref|XP_010667161.1| PREDICTED: transmembrane 9 superfamily member 7-like [Beta vulgaris subsp. vulgaris] gi|870842052|gb|KMS95562.1| hypothetical protein BVRB_007080 [Beta vulgaris subsp. vulgaris] Length = 635 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 132 SDIKWASRWDTYLLMNDGQIHWFSIINSL 46 SDIKWASRWDTYLLMND QIHWFSIINSL Sbjct: 252 SDIKWASRWDTYLLMNDDQIHWFSIINSL 280 >gb|KHG26194.1| Transmembrane 9 superfamily member 4 [Gossypium arboreum] Length = 635 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 132 SDIKWASRWDTYLLMNDGQIHWFSIINSL 46 SDIKWASRWDTYLLMND QIHWFSIINSL Sbjct: 252 SDIKWASRWDTYLLMNDDQIHWFSIINSL 280 >gb|KHF99403.1| Transmembrane 9 superfamily member 4 [Gossypium arboreum] Length = 622 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 132 SDIKWASRWDTYLLMNDGQIHWFSIINSL 46 SDIKWASRWDTYLLMND QIHWFSIINSL Sbjct: 239 SDIKWASRWDTYLLMNDDQIHWFSIINSL 267 >gb|KFK35594.1| hypothetical protein AALP_AA4G011800 [Arabis alpina] Length = 637 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 132 SDIKWASRWDTYLLMNDGQIHWFSIINSL 46 SDIKWASRWDTYLLMND QIHWFSIINSL Sbjct: 254 SDIKWASRWDTYLLMNDDQIHWFSIINSL 282 >emb|CDO97915.1| unnamed protein product [Coffea canephora] Length = 639 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 132 SDIKWASRWDTYLLMNDGQIHWFSIINSL 46 SDIKWASRWDTYLLMND QIHWFSIINSL Sbjct: 256 SDIKWASRWDTYLLMNDDQIHWFSIINSL 284 >ref|XP_008228298.1| PREDICTED: transmembrane 9 superfamily member 4-like [Prunus mume] Length = 641 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 132 SDIKWASRWDTYLLMNDGQIHWFSIINSL 46 SDIKWASRWDTYLLMND QIHWFSIINSL Sbjct: 258 SDIKWASRWDTYLLMNDDQIHWFSIINSL 286 >gb|KDO65261.1| hypothetical protein CISIN_1g040848mg [Citrus sinensis] Length = 641 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 132 SDIKWASRWDTYLLMNDGQIHWFSIINSL 46 SDIKWASRWDTYLLMND QIHWFSIINSL Sbjct: 258 SDIKWASRWDTYLLMNDDQIHWFSIINSL 286 >ref|XP_012844969.1| PREDICTED: transmembrane 9 superfamily member 7-like [Erythranthe guttatus] gi|604347697|gb|EYU45852.1| hypothetical protein MIMGU_mgv1a002772mg [Erythranthe guttata] Length = 639 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 132 SDIKWASRWDTYLLMNDGQIHWFSIINSL 46 SDIKWASRWDTYLLMND QIHWFSIINSL Sbjct: 256 SDIKWASRWDTYLLMNDDQIHWFSIINSL 284