BLASTX nr result
ID: Papaver31_contig00008072
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00008072 (580 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40698.1| hypothetical protein MIMGU_mgv1a021759mg, partial... 68 4e-09 >gb|EYU40698.1| hypothetical protein MIMGU_mgv1a021759mg, partial [Erythranthe guttata] Length = 463 Score = 67.8 bits (164), Expect = 4e-09 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 3/50 (6%) Frame = -3 Query: 578 FYCDWVKVE---SGCKMCPDSNLVVVNLDRIRSVDRYFDEPVILACEASK 438 FYCDWV+VE +GCK CPDSNLV+VN D+ +S DEPVILA EA++ Sbjct: 363 FYCDWVRVEDKVNGCKHCPDSNLVMVNFDKFKSCSSELDEPVILASEATQ 412