BLASTX nr result
ID: Papaver31_contig00007692
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00007692 (527 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013453108.1| hypothetical protein MTR_6g087780 [Medicago ... 58 3e-07 gb|KJB18362.1| hypothetical protein B456_003G048700 [Gossypium r... 52 2e-06 ref|XP_003620615.1| hypothetical protein MTR_6g087780 [Medicago ... 57 4e-06 >ref|XP_013453108.1| hypothetical protein MTR_6g087780 [Medicago truncatula] gi|657383424|gb|KEH27136.1| hypothetical protein MTR_6g087780 [Medicago truncatula] Length = 57 Score = 57.8 bits (138), Expect(2) = 3e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 123 LRLVSQEHSQLPPKSFRLSPGLRVNAVLSFLGCLRHSF 10 L+ +HSQ PPKSFRLSPGLRVNA +SFLGCLR ++ Sbjct: 10 LKACFSKHSQWPPKSFRLSPGLRVNAAVSFLGCLRSNY 47 Score = 23.5 bits (49), Expect(2) = 3e-07 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 139 VYDDKTKACFSR 104 VYDD KACFS+ Sbjct: 5 VYDDILKACFSK 16 >gb|KJB18362.1| hypothetical protein B456_003G048700 [Gossypium raimondii] Length = 86 Score = 52.0 bits (123), Expect(2) = 2e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -3 Query: 135 MMIKLRLVSQEHSQLPPKSFRLSPGLRVNAVL 40 MMI RLVSQ+HSQ PP+SFRLSPGLR +AVL Sbjct: 1 MMINQRLVSQKHSQWPPESFRLSPGLRASAVL 32 Score = 26.2 bits (56), Expect(2) = 2e-06 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 64 GLES*CCFILPWMSEALF 11 GL + FILPWMSE + Sbjct: 56 GLRACAAFILPWMSETFY 73 >ref|XP_003620615.1| hypothetical protein MTR_6g087780 [Medicago truncatula] gi|355495630|gb|AES76833.1| hypothetical protein MTR_6g087780 [Medicago truncatula] Length = 54 Score = 57.0 bits (136), Expect(2) = 4e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 105 EHSQLPPKSFRLSPGLRVNAVLSFLGCLRHSF 10 +HSQ PPKSFRLSPGLRVNA +SFLGCLR ++ Sbjct: 13 KHSQWPPKSFRLSPGLRVNAAVSFLGCLRSNY 44 Score = 20.4 bits (41), Expect(2) = 4e-06 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -2 Query: 133 DDKTKACFSR 104 DD KACFS+ Sbjct: 4 DDNIKACFSK 13