BLASTX nr result
ID: Papaver31_contig00007441
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00007441 (766 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KNA18672.1| hypothetical protein SOVF_068610 [Spinacia oleracea] 58 6e-06 >gb|KNA18672.1| hypothetical protein SOVF_068610 [Spinacia oleracea] Length = 137 Score = 58.2 bits (139), Expect = 6e-06 Identities = 27/62 (43%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Frame = -3 Query: 638 ACIEKGKSCA-FRDGRVCCPGLLCTKGLSSRATCLPCSLKGERCGLNDLCCHGLHCDGWF 462 +C +G++C+ F + CC G C S R C C KG+ CGLND CC GL C+ W Sbjct: 76 SCWAQGEACSPFISSKRCCDGYSCD---SYRGRCEWCPRKGDSCGLNDPCCPGLSCNDWL 132 Query: 461 KG 456 KG Sbjct: 133 KG 134