BLASTX nr result
ID: Papaver31_contig00006889
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00006889 (596 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010316911.1| PREDICTED: chlorophyll a-b binding protein 1... 57 9e-06 dbj|BAA32346.1| light-harvesting chlorophyll a/b-binding protein... 57 9e-06 >ref|XP_010316911.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like [Solanum lycopersicum] Length = 265 Score = 56.6 bits (135), Expect = 9e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 3 PWYGPDRVKYLGPFSGESPSYLN 71 PWYGPDRVKYLGPFSGESPSYLN Sbjct: 48 PWYGPDRVKYLGPFSGESPSYLN 70 >dbj|BAA32346.1| light-harvesting chlorophyll a/b-binding protein of photosystem II [Cryptomeria japonica] Length = 266 Score = 56.6 bits (135), Expect = 9e-06 Identities = 26/43 (60%), Positives = 29/43 (67%), Gaps = 2/43 (4%) Frame = +3 Query: 3 PWYGPDRVKYLGPFSGESPSYLNQKCSI--GGQCMCCQDHPSS 125 PWYGPDRVKYLGPFSGE PSYL + + GG CQ P + Sbjct: 49 PWYGPDRVKYLGPFSGEPPSYLTGEFPVTTGGTPPVCQPDPET 91