BLASTX nr result
ID: Papaver31_contig00006857
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00006857 (402 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009607234.1| PREDICTED: EIN3-binding F-box protein 2-like... 45 2e-06 >ref|XP_009607234.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana tomentosiformis] Length = 637 Score = 44.7 bits (104), Expect(2) = 2e-06 Identities = 27/48 (56%), Positives = 31/48 (64%), Gaps = 4/48 (8%) Frame = -3 Query: 364 VTSLARLHEEILEMQNLGDYSKVTDDSLGSIAVN----YGLDVSTCTV 233 V SLARLH E LE+ NL KVTD+SL +IA N LDVSTC + Sbjct: 519 VLSLARLHGETLELLNLDGCRKVTDESLMAIADNCPLLNDLDVSTCAI 566 Score = 33.9 bits (76), Expect(2) = 2e-06 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = -2 Query: 176 SKGLTYLADMGDPLMGLNLQHCKSLRNCMTDLVELLY 66 +K + YL +G+ L+GLNLQHC + + LVE L+ Sbjct: 595 NKSVPYLKKLGENLLGLNLQHCSVSCSAVELLVEDLW 631