BLASTX nr result
ID: Papaver31_contig00006457
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00006457 (1034 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012085777.1| PREDICTED: aspartic proteinase-like protein ... 59 8e-06 ref|XP_002514831.1| Aspartic proteinase Asp1 precursor, putative... 59 8e-06 >ref|XP_012085777.1| PREDICTED: aspartic proteinase-like protein 2 [Jatropha curcas] gi|643714215|gb|KDP26880.1| hypothetical protein JCGZ_18038 [Jatropha curcas] Length = 483 Score = 58.5 bits (140), Expect = 8e-06 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 552 CGAKQSGHFVTSTKALDGLLSFGQENTSMISQLAAAG 442 CGAKQSG TS++ALDG+L FGQ N+SMISQLAAAG Sbjct: 202 CGAKQSGELGTSSEALDGILGFGQANSSMISQLAAAG 238 >ref|XP_002514831.1| Aspartic proteinase Asp1 precursor, putative [Ricinus communis] gi|223545882|gb|EEF47385.1| Aspartic proteinase Asp1 precursor, putative [Ricinus communis] Length = 488 Score = 58.5 bits (140), Expect = 8e-06 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 552 CGAKQSGHFVTSTKALDGLLSFGQENTSMISQLAAAG 442 CGAKQSG TS++ALDG+L FGQ N+SMISQLAAAG Sbjct: 207 CGAKQSGELGTSSEALDGILGFGQANSSMISQLAAAG 243