BLASTX nr result
ID: Papaver31_contig00006235
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00006235 (439 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012070443.1| PREDICTED: arabinogalactan peptide 13-like [... 58 3e-06 >ref|XP_012070443.1| PREDICTED: arabinogalactan peptide 13-like [Jatropha curcas] gi|643732600|gb|KDP39696.1| hypothetical protein JCGZ_02716 [Jatropha curcas] Length = 59 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/59 (50%), Positives = 37/59 (62%) Frame = -1 Query: 283 MESLKMRVFIAMIFMVMAASSVQNVXXXXXXXXXXXXXXXSFVPAVFASLTALVFGLLF 107 ME+LKMRVF+A++ +VMA S+VQNV FVP +FAS AL FGLLF Sbjct: 1 MEALKMRVFLALVVVVMAFSAVQNVAAQEAPAPSPASDATIFVPTIFASFVALAFGLLF 59