BLASTX nr result
ID: Papaver31_contig00005444
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00005444 (389 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW81802.1| hypothetical protein EUGRSUZ_C03158 [Eucalyptus g... 60 8e-07 ref|XP_010049280.1| PREDICTED: F-box/LRR-repeat protein 15 [Euca... 60 8e-07 >gb|KCW81802.1| hypothetical protein EUGRSUZ_C03158 [Eucalyptus grandis] Length = 957 Score = 59.7 bits (143), Expect = 8e-07 Identities = 51/129 (39%), Positives = 60/129 (46%), Gaps = 29/129 (22%) Frame = -3 Query: 363 VEGKHLMEVGIRSLNLGICP---ELDIAAPTVI*QP-------T*KMIACLLPQGLHA-- 220 +E H VG+ SLNLGICP EL I AP ++ I C L L A Sbjct: 659 LEKAHFCPVGLGSLNLGICPKLSELTIEAPKMVLLELKGCGVLAEASINCPLLTSLDASF 718 Query: 219 -------LLSRQ*FRCPA-KLLVLMAFP---------LFWLSHLTFLGLSYNF*LDLLPV 91 LS CP + L+LM+ P L WL HLT L LSY F +L+PV Sbjct: 719 CSRLRDDCLSATATSCPLIESLILMSCPSVGSDGLYSLCWLPHLTMLDLSYTFLTNLVPV 778 Query: 90 FGSCLQLKV 64 F SCL LKV Sbjct: 779 FESCLHLKV 787 >ref|XP_010049280.1| PREDICTED: F-box/LRR-repeat protein 15 [Eucalyptus grandis] gi|629117125|gb|KCW81800.1| hypothetical protein EUGRSUZ_C03158 [Eucalyptus grandis] gi|629117126|gb|KCW81801.1| hypothetical protein EUGRSUZ_C03158 [Eucalyptus grandis] Length = 1017 Score = 59.7 bits (143), Expect = 8e-07 Identities = 51/129 (39%), Positives = 60/129 (46%), Gaps = 29/129 (22%) Frame = -3 Query: 363 VEGKHLMEVGIRSLNLGICP---ELDIAAPTVI*QP-------T*KMIACLLPQGLHA-- 220 +E H VG+ SLNLGICP EL I AP ++ I C L L A Sbjct: 659 LEKAHFCPVGLGSLNLGICPKLSELTIEAPKMVLLELKGCGVLAEASINCPLLTSLDASF 718 Query: 219 -------LLSRQ*FRCPA-KLLVLMAFP---------LFWLSHLTFLGLSYNF*LDLLPV 91 LS CP + L+LM+ P L WL HLT L LSY F +L+PV Sbjct: 719 CSRLRDDCLSATATSCPLIESLILMSCPSVGSDGLYSLCWLPHLTMLDLSYTFLTNLVPV 778 Query: 90 FGSCLQLKV 64 F SCL LKV Sbjct: 779 FESCLHLKV 787