BLASTX nr result
ID: Papaver31_contig00005175
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00005175 (686 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG12330.1|AF249743_1 heterotrimeric GTP-binding protein subu... 50 3e-08 gb|AJE63427.1| heterotrimeric G protein beta 2 subunit [Capsicum... 49 6e-08 gb|AIL52187.1| heterotrimeric G-protein beta subunit [Capsicum a... 49 6e-08 gb|ACR77529.1| heterotrimeric G protein beta 2 subunit [Nicotian... 48 8e-08 ref|XP_014493826.1| PREDICTED: guanine nucleotide-binding protei... 47 8e-08 gb|KOM50890.1| hypothetical protein LR48_Vigan08g171700 [Vigna a... 47 8e-08 ref|XP_008375922.1| PREDICTED: guanine nucleotide-binding protei... 49 1e-07 ref|XP_004230907.1| PREDICTED: guanine nucleotide-binding protei... 48 1e-07 sp|P93563.1|GBB_SOLTU RecName: Full=Guanine nucleotide-binding p... 48 1e-07 ref|NP_001274886.1| guanine nucleotide-binding protein subunit b... 48 1e-07 sp|P93339.1|GBB_NICPL RecName: Full=Guanine nucleotide-binding p... 47 1e-07 ref|XP_009605958.1| PREDICTED: guanine nucleotide-binding protei... 47 1e-07 ref|XP_009800901.1| PREDICTED: guanine nucleotide-binding protei... 47 1e-07 sp|Q40507.1|GBB3_TOBAC RecName: Full=Guanine nucleotide-binding ... 47 1e-07 gb|AAA84896.1| heterotrimeric GTP-binding protein beta subunit, ... 47 1e-07 ref|XP_009609408.1| PREDICTED: guanine nucleotide-binding protei... 49 2e-07 ref|XP_009779361.1| PREDICTED: guanine nucleotide-binding protei... 47 2e-07 ref|XP_009779362.1| PREDICTED: guanine nucleotide-binding protei... 47 2e-07 gb|KDO49093.1| hypothetical protein CISIN_1g016458mg [Citrus sin... 46 3e-07 gb|KDO49095.1| hypothetical protein CISIN_1g016458mg [Citrus sin... 46 3e-07 >gb|AAG12330.1|AF249743_1 heterotrimeric GTP-binding protein subunit beta 1 [Nicotiana tabacum] Length = 377 Score = 49.7 bits (117), Expect(2) = 3e-08 Identities = 32/64 (50%), Positives = 39/64 (60%), Gaps = 5/64 (7%) Frame = +3 Query: 87 EGDDNRLRWSRELHFVNTPE----FRLFDMRTGHQLQVYQQP-GGSDIHTVYSTSFSSYD 251 EGD N +++S + + T RLFD+RTGHQLQVY QP G DI V S +FS Sbjct: 248 EGDVNTVKFSPDGNRFGTGSEDGTCRLFDIRTGHQLQVYYQPHGDGDIPHVTSMAFSISG 307 Query: 252 RLLF 263 RLLF Sbjct: 308 RLLF 311 Score = 35.8 bits (81), Expect(2) = 3e-08 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 269 YSNWDCFVWDTLLAKVEID 325 YSN DC+VWDTLLAKV ++ Sbjct: 314 YSNGDCYVWDTLLAKVVLN 332 >gb|AJE63427.1| heterotrimeric G protein beta 2 subunit [Capsicum annuum] Length = 377 Score = 48.9 bits (115), Expect(2) = 6e-08 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 1/39 (2%) Frame = +3 Query: 150 RLFDMRTGHQLQVYQQP-GGSDIHTVYSTSFSSYDRLLF 263 RLFD+RTGHQLQVY QP G SDI V S +FS RLLF Sbjct: 273 RLFDIRTGHQLQVYYQPHGDSDIPHVTSMAFSISGRLLF 311 Score = 35.4 bits (80), Expect(2) = 6e-08 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 269 YSNWDCFVWDTLLAKVEID 325 YSN DC+VWDTLLAKV ++ Sbjct: 314 YSNADCYVWDTLLAKVVLN 332 >gb|AIL52187.1| heterotrimeric G-protein beta subunit [Capsicum annuum] Length = 377 Score = 48.9 bits (115), Expect(2) = 6e-08 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 1/39 (2%) Frame = +3 Query: 150 RLFDMRTGHQLQVYQQP-GGSDIHTVYSTSFSSYDRLLF 263 RLFD+RTGHQLQVY QP G SDI V S +FS RLLF Sbjct: 273 RLFDIRTGHQLQVYYQPHGDSDIPHVTSMAFSISGRLLF 311 Score = 35.4 bits (80), Expect(2) = 6e-08 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 269 YSNWDCFVWDTLLAKVEID 325 YSN DC+VWDTLLAKV ++ Sbjct: 314 YSNADCYVWDTLLAKVVLN 332 >gb|ACR77529.1| heterotrimeric G protein beta 2 subunit [Nicotiana benthamiana] Length = 377 Score = 48.1 bits (113), Expect(2) = 8e-08 Identities = 31/64 (48%), Positives = 38/64 (59%), Gaps = 5/64 (7%) Frame = +3 Query: 87 EGDDNRLRWSRELHFVNTPE----FRLFDMRTGHQLQVYQQP-GGSDIHTVYSTSFSSYD 251 EGD N +++ + + T RLFD+RTGHQLQVY QP G DI V S +FS Sbjct: 248 EGDVNTVKFFPDSNRFGTGSEDGTCRLFDIRTGHQLQVYYQPHGDGDIPHVTSMAFSISG 307 Query: 252 RLLF 263 RLLF Sbjct: 308 RLLF 311 Score = 35.8 bits (81), Expect(2) = 8e-08 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 269 YSNWDCFVWDTLLAKVEID 325 YSN DC+VWDTLLAKV ++ Sbjct: 314 YSNGDCYVWDTLLAKVVLN 332 >ref|XP_014493826.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2 [Vigna radiata var. radiata] Length = 377 Score = 47.4 bits (111), Expect(2) = 8e-08 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 1/40 (2%) Frame = +3 Query: 150 RLFDMRTGHQLQV-YQQPGGSDIHTVYSTSFSSYDRLLFA 266 RLFD+RTGHQLQV YQQ +DI V S +FS+ RLLFA Sbjct: 273 RLFDIRTGHQLQVYYQQHSDNDIPPVTSIAFSASGRLLFA 312 Score = 36.6 bits (83), Expect(2) = 8e-08 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 269 YSNWDCFVWDTLLAKVEID 325 Y+N DC+VWDTLLAKV +D Sbjct: 314 YTNGDCYVWDTLLAKVVLD 332 >gb|KOM50890.1| hypothetical protein LR48_Vigan08g171700 [Vigna angularis] Length = 377 Score = 47.4 bits (111), Expect(2) = 8e-08 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 1/40 (2%) Frame = +3 Query: 150 RLFDMRTGHQLQV-YQQPGGSDIHTVYSTSFSSYDRLLFA 266 RLFD+RTGHQLQV YQQ +DI V S +FS+ RLLFA Sbjct: 273 RLFDIRTGHQLQVYYQQHSDNDIPPVTSIAFSASGRLLFA 312 Score = 36.6 bits (83), Expect(2) = 8e-08 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 269 YSNWDCFVWDTLLAKVEID 325 Y+N DC+VWDTLLAKV +D Sbjct: 314 YTNGDCYVWDTLLAKVVLD 332 >ref|XP_008375922.1| PREDICTED: guanine nucleotide-binding protein subunit beta-1 [Malus domestica] Length = 377 Score = 48.9 bits (115), Expect(2) = 1e-07 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 1/40 (2%) Frame = +3 Query: 150 RLFDMRTGHQLQVYQQP-GGSDIHTVYSTSFSSYDRLLFA 266 RLFD+RTGHQLQVY QP G +DI V + +FS RLLFA Sbjct: 273 RLFDIRTGHQLQVYHQPHGDNDIPPVKTIAFSISGRLLFA 312 Score = 34.7 bits (78), Expect(2) = 1e-07 Identities = 13/19 (68%), Positives = 17/19 (89%) Frame = +2 Query: 269 YSNWDCFVWDTLLAKVEID 325 Y+N DC+VWDTLLAKV ++ Sbjct: 314 YTNGDCYVWDTLLAKVVLN 332 >ref|XP_004230907.1| PREDICTED: guanine nucleotide-binding protein subunit beta [Solanum lycopersicum] Length = 377 Score = 47.8 bits (112), Expect(2) = 1e-07 Identities = 26/39 (66%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = +3 Query: 150 RLFDMRTGHQLQVYQQP-GGSDIHTVYSTSFSSYDRLLF 263 RLFD+RTGHQLQVY QP G DI V S +FS RLLF Sbjct: 273 RLFDIRTGHQLQVYNQPHGDGDIPHVTSMAFSISGRLLF 311 Score = 35.8 bits (81), Expect(2) = 1e-07 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 269 YSNWDCFVWDTLLAKVEID 325 YSN DC+VWDTLLAKV ++ Sbjct: 314 YSNGDCYVWDTLLAKVVLN 332 >sp|P93563.1|GBB_SOLTU RecName: Full=Guanine nucleotide-binding protein subunit beta gi|1771734|emb|CAA61106.1| GB1 protein [Solanum tuberosum] Length = 377 Score = 47.8 bits (112), Expect(2) = 1e-07 Identities = 26/39 (66%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = +3 Query: 150 RLFDMRTGHQLQVYQQP-GGSDIHTVYSTSFSSYDRLLF 263 RLFD+RTGHQLQVY QP G DI V S +FS RLLF Sbjct: 273 RLFDIRTGHQLQVYNQPHGDGDIPHVTSMAFSISGRLLF 311 Score = 35.8 bits (81), Expect(2) = 1e-07 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 269 YSNWDCFVWDTLLAKVEID 325 YSN DC+VWDTLLAKV ++ Sbjct: 314 YSNGDCYVWDTLLAKVVLN 332 >ref|NP_001274886.1| guanine nucleotide-binding protein subunit beta [Solanum tuberosum] gi|15778632|gb|AAL07488.1|AF414114_1 G protein beta subunit 2 [Solanum tuberosum] Length = 377 Score = 47.8 bits (112), Expect(2) = 1e-07 Identities = 26/39 (66%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = +3 Query: 150 RLFDMRTGHQLQVYQQP-GGSDIHTVYSTSFSSYDRLLF 263 RLFD+RTGHQLQVY QP G DI V S +FS RLLF Sbjct: 273 RLFDIRTGHQLQVYNQPHGDGDIPHVTSIAFSISGRLLF 311 Score = 35.8 bits (81), Expect(2) = 1e-07 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 269 YSNWDCFVWDTLLAKVEID 325 YSN DC+VWDTLLAKV ++ Sbjct: 314 YSNGDCYVWDTLLAKVVLN 332 >sp|P93339.1|GBB_NICPL RecName: Full=Guanine nucleotide-binding protein subunit beta; AltName: Full=NpGPB1 gi|1695179|emb|CAA70704.1| G protein beta subunit [Nicotiana plumbaginifolia] Length = 377 Score = 47.4 bits (111), Expect(2) = 1e-07 Identities = 26/39 (66%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = +3 Query: 150 RLFDMRTGHQLQVYQQP-GGSDIHTVYSTSFSSYDRLLF 263 RLFD+RTGHQLQVY QP G DI V S +FS RLLF Sbjct: 273 RLFDIRTGHQLQVYYQPHGDGDIPHVTSMAFSISGRLLF 311 Score = 35.8 bits (81), Expect(2) = 1e-07 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 269 YSNWDCFVWDTLLAKVEID 325 YSN DC+VWDTLLAKV ++ Sbjct: 314 YSNGDCYVWDTLLAKVVLN 332 >ref|XP_009605958.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2 [Nicotiana tomentosiformis] gi|3023839|sp|P93398.1|GBB2_TOBAC RecName: Full=Guanine nucleotide-binding protein subunit beta-2 gi|1835163|emb|CAB06619.1| G protein beta subunit [Nicotiana tabacum] Length = 377 Score = 47.4 bits (111), Expect(2) = 1e-07 Identities = 26/39 (66%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = +3 Query: 150 RLFDMRTGHQLQVYQQP-GGSDIHTVYSTSFSSYDRLLF 263 RLFD+RTGHQLQVY QP G DI V S +FS RLLF Sbjct: 273 RLFDIRTGHQLQVYYQPHGDGDIPHVTSMAFSISGRLLF 311 Score = 35.8 bits (81), Expect(2) = 1e-07 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 269 YSNWDCFVWDTLLAKVEID 325 YSN DC+VWDTLLAKV ++ Sbjct: 314 YSNGDCYVWDTLLAKVVLN 332 >ref|XP_009800901.1| PREDICTED: guanine nucleotide-binding protein subunit beta-1 [Nicotiana sylvestris] Length = 377 Score = 47.4 bits (111), Expect(2) = 1e-07 Identities = 26/39 (66%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = +3 Query: 150 RLFDMRTGHQLQVYQQP-GGSDIHTVYSTSFSSYDRLLF 263 RLFD+RTGHQLQVY QP G DI V S +FS RLLF Sbjct: 273 RLFDIRTGHQLQVYYQPHGDGDIPHVTSMAFSISGRLLF 311 Score = 35.8 bits (81), Expect(2) = 1e-07 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 269 YSNWDCFVWDTLLAKVEID 325 YSN DC+VWDTLLAKV ++ Sbjct: 314 YSNGDCYVWDTLLAKVVLN 332 >sp|Q40507.1|GBB3_TOBAC RecName: Full=Guanine nucleotide-binding protein subunit beta gi|1360092|emb|CAA66842.1| G protein [Nicotiana tabacum] Length = 375 Score = 47.4 bits (111), Expect(2) = 1e-07 Identities = 26/39 (66%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = +3 Query: 150 RLFDMRTGHQLQVYQQP-GGSDIHTVYSTSFSSYDRLLF 263 RLFD+RTGHQLQVY QP G DI V S +FS RLLF Sbjct: 273 RLFDIRTGHQLQVYYQPHGDGDIPHVTSMAFSISGRLLF 311 Score = 35.8 bits (81), Expect(2) = 1e-07 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 269 YSNWDCFVWDTLLAKVEID 325 YSN DC+VWDTLLAKV ++ Sbjct: 314 YSNGDCYVWDTLLAKVVLN 332 >gb|AAA84896.1| heterotrimeric GTP-binding protein beta subunit, partial [Nicotiana tabacum] Length = 240 Score = 47.4 bits (111), Expect(2) = 1e-07 Identities = 26/39 (66%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = +3 Query: 150 RLFDMRTGHQLQVYQQP-GGSDIHTVYSTSFSSYDRLLF 263 RLFD+RTGHQLQVY QP G DI V S +FS RLLF Sbjct: 152 RLFDIRTGHQLQVYYQPHGDGDIPHVTSMAFSISGRLLF 190 Score = 35.8 bits (81), Expect(2) = 1e-07 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 269 YSNWDCFVWDTLLAKVEID 325 YSN DC+VWDTLLAKV ++ Sbjct: 193 YSNGDCYVWDTLLAKVVLN 211 >ref|XP_009609408.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like [Nicotiana tomentosiformis] Length = 380 Score = 48.9 bits (115), Expect(2) = 2e-07 Identities = 27/40 (67%), Positives = 29/40 (72%), Gaps = 1/40 (2%) Frame = +3 Query: 150 RLFDMRTGHQLQVYQQP-GGSDIHTVYSTSFSSYDRLLFA 266 RLFD+RTGHQLQVY QP G DI V S +FS RLLFA Sbjct: 276 RLFDIRTGHQLQVYYQPHGDGDIPHVTSIAFSISGRLLFA 315 Score = 33.5 bits (75), Expect(2) = 2e-07 Identities = 12/19 (63%), Positives = 17/19 (89%) Frame = +2 Query: 269 YSNWDCFVWDTLLAKVEID 325 YSN DC++WDTLLAK+ ++ Sbjct: 317 YSNGDCYMWDTLLAKMVLN 335 >ref|XP_009779361.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like isoform X1 [Nicotiana sylvestris] Length = 380 Score = 46.6 bits (109), Expect(2) = 2e-07 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 1/40 (2%) Frame = +3 Query: 150 RLFDMRTGHQLQVYQQP-GGSDIHTVYSTSFSSYDRLLFA 266 RLFD+RTGHQLQVY QP G D+ V S FS RLLFA Sbjct: 276 RLFDIRTGHQLQVYYQPHGDGDMPHVTSIVFSISGRLLFA 315 Score = 35.8 bits (81), Expect(2) = 2e-07 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 269 YSNWDCFVWDTLLAKVEID 325 YSN DC+VWDTLLAKV ++ Sbjct: 317 YSNGDCYVWDTLLAKVVLN 335 >ref|XP_009779362.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like isoform X2 [Nicotiana sylvestris] Length = 337 Score = 46.6 bits (109), Expect(2) = 2e-07 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 1/40 (2%) Frame = +3 Query: 150 RLFDMRTGHQLQVYQQP-GGSDIHTVYSTSFSSYDRLLFA 266 RLFD+RTGHQLQVY QP G D+ V S FS RLLFA Sbjct: 233 RLFDIRTGHQLQVYYQPHGDGDMPHVTSIVFSISGRLLFA 272 Score = 35.8 bits (81), Expect(2) = 2e-07 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 269 YSNWDCFVWDTLLAKVEID 325 YSN DC+VWDTLLAKV ++ Sbjct: 274 YSNGDCYVWDTLLAKVVLN 292 >gb|KDO49093.1| hypothetical protein CISIN_1g016458mg [Citrus sinensis] Length = 389 Score = 46.2 bits (108), Expect(2) = 3e-07 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 1/40 (2%) Frame = +3 Query: 150 RLFDMRTGHQLQV-YQQPGGSDIHTVYSTSFSSYDRLLFA 266 RLFD+RTGHQLQV YQQ G ++I V S +FS RLLFA Sbjct: 275 RLFDIRTGHQLQVYYQQHGENEIPHVTSIAFSISGRLLFA 314 Score = 35.8 bits (81), Expect(2) = 3e-07 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 269 YSNWDCFVWDTLLAKVEID 325 YSN DC+VWDTLLAKV ++ Sbjct: 316 YSNGDCYVWDTLLAKVVLN 334 >gb|KDO49095.1| hypothetical protein CISIN_1g016458mg [Citrus sinensis] Length = 388 Score = 46.2 bits (108), Expect(2) = 3e-07 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 1/40 (2%) Frame = +3 Query: 150 RLFDMRTGHQLQV-YQQPGGSDIHTVYSTSFSSYDRLLFA 266 RLFD+RTGHQLQV YQQ G ++I V S +FS RLLFA Sbjct: 275 RLFDIRTGHQLQVYYQQHGENEIPHVTSIAFSISGRLLFA 314 Score = 35.8 bits (81), Expect(2) = 3e-07 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +2 Query: 269 YSNWDCFVWDTLLAKVEID 325 YSN DC+VWDTLLAKV ++ Sbjct: 316 YSNGDCYVWDTLLAKVVLN 334