BLASTX nr result
ID: Papaver31_contig00003674
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00003674 (664 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012087139.1| PREDICTED: probable trehalose-phosphate phos... 60 9e-07 >ref|XP_012087139.1| PREDICTED: probable trehalose-phosphate phosphatase F isoform X2 [Jatropha curcas] Length = 413 Score = 60.5 bits (145), Expect = 9e-07 Identities = 27/38 (71%), Positives = 29/38 (76%) Frame = +2 Query: 320 MQCRIGDEKFSGIVHLMDCIRHCSDKKTLKKWFFIDKR 433 MQC GDEK SG + LMDC SDKKTLK+WFFIDKR Sbjct: 1 MQCSFGDEKLSGSLCLMDCFPSSSDKKTLKRWFFIDKR 38