BLASTX nr result
ID: Papaver31_contig00003510
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00003510 (467 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010674472.1| PREDICTED: hydrophobic protein RCI2B [Beta v... 86 1e-14 ref|XP_006408015.1| hypothetical protein EUTSA_v10021802mg [Eutr... 86 1e-14 ref|XP_011621874.1| PREDICTED: hydrophobic protein RCI2B [Ambore... 84 4e-14 ref|XP_008776672.1| PREDICTED: hydrophobic protein RCI2B-like [P... 84 4e-14 ref|XP_003626132.1| low temperature and salt responsive family p... 84 4e-14 ref|XP_004494505.1| PREDICTED: hydrophobic protein LTI6B [Cicer ... 84 4e-14 gb|AAF26091.1|AC012393_17 low temperature and salt responsive pr... 84 5e-14 ref|NP_187240.1| Hydrophobic protein RCI2B [Arabidopsis thaliana... 84 5e-14 gb|AFC41201.1| PM-YC3.6-Lti6b [Binary expression vector PM-YC3.6... 84 5e-14 ref|XP_002884539.1| low temperature and salt responsive protein ... 84 5e-14 ref|XP_009412350.1| PREDICTED: hydrophobic protein RCI2B [Musa a... 83 7e-14 gb|AFK38849.1| unknown [Lotus japonicus] gi|388522485|gb|AFK4930... 83 7e-14 gb|AFI47457.1| low temperature and salt responsive protein [Medi... 83 7e-14 ref|XP_010694119.1| PREDICTED: hydrophobic protein LTI6A [Beta v... 83 9e-14 ref|XP_010271058.1| PREDICTED: hydrophobic protein RCI2B [Nelumb... 83 9e-14 ref|XP_014511134.1| PREDICTED: hydrophobic protein RCI2B [Vigna ... 82 1e-13 ref|XP_012854064.1| PREDICTED: hydrophobic protein RCI2B-like [E... 82 1e-13 ref|XP_012464989.1| PREDICTED: hydrophobic protein RCI2B [Gossyp... 82 1e-13 gb|KHG20782.1| Hydrophobic RCI2B -like protein [Gossypium arboreum] 82 1e-13 ref|XP_006428346.1| hypothetical protein CICLE_v10013304mg [Citr... 82 1e-13 >ref|XP_010674472.1| PREDICTED: hydrophobic protein RCI2B [Beta vulgaris subsp. vulgaris] gi|731327338|ref|XP_010674473.1| PREDICTED: hydrophobic protein RCI2B [Beta vulgaris subsp. vulgaris] gi|870862925|gb|KMT14113.1| hypothetical protein BVRB_4g079350 [Beta vulgaris subsp. vulgaris] Length = 54 Score = 85.9 bits (211), Expect = 1e-14 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -1 Query: 467 IILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 345 IILAIILPPLGVFLK+GCKVEFWICLVLTLLGYLPGIIYAI Sbjct: 9 IILAIILPPLGVFLKYGCKVEFWICLVLTLLGYLPGIIYAI 49 >ref|XP_006408015.1| hypothetical protein EUTSA_v10021802mg [Eutrema salsugineum] gi|557109161|gb|ESQ49468.1| hypothetical protein EUTSA_v10021802mg [Eutrema salsugineum] Length = 111 Score = 85.5 bits (210), Expect = 1e-14 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -1 Query: 467 IILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 345 IILAIILPPLGVFLKFGCK+EFWICL+LTLLGYLPGIIYA+ Sbjct: 65 IILAIILPPLGVFLKFGCKIEFWICLILTLLGYLPGIIYAL 105 >ref|XP_011621874.1| PREDICTED: hydrophobic protein RCI2B [Amborella trichopoda] Length = 56 Score = 84.0 bits (206), Expect = 4e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -1 Query: 467 IILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 345 IILAIILPPLGVFLKFGCKVEFWICLVLTL GY+PGIIYA+ Sbjct: 11 IILAIILPPLGVFLKFGCKVEFWICLVLTLFGYVPGIIYAV 51 >ref|XP_008776672.1| PREDICTED: hydrophobic protein RCI2B-like [Phoenix dactylifera] gi|672195925|ref|XP_008776673.1| PREDICTED: hydrophobic protein RCI2B-like [Phoenix dactylifera] Length = 57 Score = 84.0 bits (206), Expect = 4e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -1 Query: 467 IILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 345 I+LAIILPPLGVFLKFGCKVEFW+CLVLTL GYLPGIIYAI Sbjct: 12 ILLAIILPPLGVFLKFGCKVEFWLCLVLTLFGYLPGIIYAI 52 >ref|XP_003626132.1| low temperature and salt responsive family protein [Medicago truncatula] gi|87241339|gb|ABD33197.1| Protein of unknown function UPF0057 [Medicago truncatula] gi|355501147|gb|AES82350.1| low temperature and salt responsive family protein [Medicago truncatula] gi|388497498|gb|AFK36815.1| unknown [Medicago truncatula] Length = 54 Score = 84.0 bits (206), Expect = 4e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -1 Query: 467 IILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 345 IILAIILPPLGVFLKFGC VEFWICL+LT+LGYLPGIIYAI Sbjct: 9 IILAIILPPLGVFLKFGCNVEFWICLILTILGYLPGIIYAI 49 >ref|XP_004494505.1| PREDICTED: hydrophobic protein LTI6B [Cicer arietinum] Length = 54 Score = 84.0 bits (206), Expect = 4e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -1 Query: 467 IILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 345 IILAIILPPLGVFLKFGC VEFWICL+LT+LGYLPGIIYAI Sbjct: 9 IILAIILPPLGVFLKFGCNVEFWICLILTILGYLPGIIYAI 49 >gb|AAF26091.1|AC012393_17 low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] Length = 67 Score = 83.6 bits (205), Expect = 5e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 467 IILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 345 IILAIILPPLGVFLKFGCKVEFWICL+LTL GYLPGI+YA+ Sbjct: 9 IILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYAL 49 >ref|NP_187240.1| Hydrophobic protein RCI2B [Arabidopsis thaliana] gi|15214252|sp|Q9ZNS6.1|RCI2B_ARATH RecName: Full=Hydrophobic protein RCI2B; AltName: Full=Low temperature and salt-responsive protein LTI6B gi|6671968|gb|AAF23227.1|AC013454_14 low temperature and salt responsive protein (LTI6B) [Arabidopsis thaliana] gi|13957673|gb|AAK50618.1|AF264749_1 hydrophobic protein RCI2B [Arabidopsis thaliana] gi|4039152|gb|AAC97511.1| low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] gi|4325219|gb|AAD17303.1| hydrophobic protein [Arabidopsis thaliana] gi|21536934|gb|AAM61275.1| hydrophobic protein RCI2B (Low temperature and salt responsive protein LTI6B) [Arabidopsis thaliana] gi|51970648|dbj|BAD44016.1| low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] gi|109134195|gb|ABG25095.1| At3g05890 [Arabidopsis thaliana] gi|110737346|dbj|BAF00618.1| low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] gi|332640791|gb|AEE74312.1| Hydrophobic protein RCI2B [Arabidopsis thaliana] Length = 54 Score = 83.6 bits (205), Expect = 5e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 467 IILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 345 IILAIILPPLGVFLKFGCKVEFWICL+LTL GYLPGI+YA+ Sbjct: 9 IILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYAL 49 >gb|AFC41201.1| PM-YC3.6-Lti6b [Binary expression vector PM-YC3.6-LTI6b] Length = 726 Score = 83.6 bits (205), Expect = 5e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 467 IILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 345 IILAIILPPLGVFLKFGCKVEFWICL+LTL GYLPGI+YA+ Sbjct: 681 IILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYAL 721 >ref|XP_002884539.1| low temperature and salt responsive protein LTI6B [Arabidopsis lyrata subsp. lyrata] gi|297330379|gb|EFH60798.1| low temperature and salt responsive protein LTI6B [Arabidopsis lyrata subsp. lyrata] Length = 67 Score = 83.6 bits (205), Expect = 5e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 467 IILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 345 IILAIILPPLGVFLKFGCKVEFWICL+LTL GYLPGI+YA+ Sbjct: 9 IILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYAL 49 >ref|XP_009412350.1| PREDICTED: hydrophobic protein RCI2B [Musa acuminata subsp. malaccensis] Length = 57 Score = 83.2 bits (204), Expect = 7e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 467 IILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 345 I+LAIILPPLGVFLKFGCKVEFWICL+LTL GYLPGIIYA+ Sbjct: 12 ILLAIILPPLGVFLKFGCKVEFWICLLLTLFGYLPGIIYAV 52 >gb|AFK38849.1| unknown [Lotus japonicus] gi|388522485|gb|AFK49304.1| unknown [Lotus japonicus] Length = 54 Score = 83.2 bits (204), Expect = 7e-14 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = -1 Query: 467 IILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 345 IILAIILPPLGVFL+FGCKVEFWICL+LT+LGY+PGIIYAI Sbjct: 9 IILAIILPPLGVFLRFGCKVEFWICLLLTILGYIPGIIYAI 49 >gb|AFI47457.1| low temperature and salt responsive protein [Medicago sativa] Length = 54 Score = 83.2 bits (204), Expect = 7e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 467 IILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 345 IILAIILPPLGVFLKFGC VEFWICL+LT+LGYLPGI+YAI Sbjct: 9 IILAIILPPLGVFLKFGCNVEFWICLILTILGYLPGILYAI 49 >ref|XP_010694119.1| PREDICTED: hydrophobic protein LTI6A [Beta vulgaris subsp. vulgaris] gi|870845968|gb|KMS98602.1| hypothetical protein BVRB_3g070450 [Beta vulgaris subsp. vulgaris] Length = 56 Score = 82.8 bits (203), Expect = 9e-14 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -1 Query: 467 IILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 345 I+LAIILPPLGVFLKFGCKVEFWICLVLT GYLPGIIYA+ Sbjct: 11 ILLAIILPPLGVFLKFGCKVEFWICLVLTFFGYLPGIIYAV 51 >ref|XP_010271058.1| PREDICTED: hydrophobic protein RCI2B [Nelumbo nucifera] Length = 57 Score = 82.8 bits (203), Expect = 9e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 467 IILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 345 I+LAIILPPLGVFLKFGCKVEFWICL+LTL GY+PGIIYAI Sbjct: 12 ILLAIILPPLGVFLKFGCKVEFWICLLLTLFGYIPGIIYAI 52 >ref|XP_014511134.1| PREDICTED: hydrophobic protein RCI2B [Vigna radiata var. radiata] gi|920692191|gb|KOM35416.1| hypothetical protein LR48_Vigan02g156600 [Vigna angularis] Length = 57 Score = 82.4 bits (202), Expect = 1e-13 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = -1 Query: 467 IILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 345 I+LAIILPPLGVFLK+GCKVEFWICLVLTL GY+PGIIYA+ Sbjct: 12 ILLAIILPPLGVFLKYGCKVEFWICLVLTLFGYIPGIIYAV 52 >ref|XP_012854064.1| PREDICTED: hydrophobic protein RCI2B-like [Erythranthe guttatus] Length = 55 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 467 IILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 345 IILAIILPPLGVFLKFGCK+EFWICL+LT+ GYLPGIIYAI Sbjct: 9 IILAIILPPLGVFLKFGCKLEFWICLLLTIFGYLPGIIYAI 49 >ref|XP_012464989.1| PREDICTED: hydrophobic protein RCI2B [Gossypium raimondii] gi|763815865|gb|KJB82717.1| hypothetical protein B456_013G210800 [Gossypium raimondii] gi|763815866|gb|KJB82718.1| hypothetical protein B456_013G210800 [Gossypium raimondii] Length = 57 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 467 IILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 345 I+LAIILPPLGVFLKFGC+VEFWICLVLTL GY+PGIIYAI Sbjct: 12 ILLAIILPPLGVFLKFGCQVEFWICLVLTLFGYIPGIIYAI 52 >gb|KHG20782.1| Hydrophobic RCI2B -like protein [Gossypium arboreum] Length = 57 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 467 IILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 345 I+LAIILPPLGVFLKFGC+VEFWICLVLTL GY+PGIIYAI Sbjct: 12 ILLAIILPPLGVFLKFGCQVEFWICLVLTLFGYIPGIIYAI 52 >ref|XP_006428346.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|567871515|ref|XP_006428347.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|568853386|ref|XP_006480340.1| PREDICTED: hydrophobic protein LTI6A-like [Citrus sinensis] gi|557530403|gb|ESR41586.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|557530404|gb|ESR41587.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|641837447|gb|KDO56401.1| hypothetical protein CISIN_1g035460mg [Citrus sinensis] gi|641837448|gb|KDO56402.1| hypothetical protein CISIN_1g035460mg [Citrus sinensis] Length = 58 Score = 82.4 bits (202), Expect = 1e-13 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = -1 Query: 467 IILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 345 IILAIILPPLGVFLKFGCKVEFWICL+LT+ GY+PGIIYA+ Sbjct: 12 IILAIILPPLGVFLKFGCKVEFWICLLLTIFGYIPGIIYAV 52