BLASTX nr result
ID: Papaver31_contig00002599
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00002599 (1979 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012831211.1| PREDICTED: transmembrane protein 87A-like [E... 80 9e-12 ref|XP_012856789.1| PREDICTED: transmembrane protein 87A [Erythr... 79 1e-11 ref|XP_010273861.1| PREDICTED: transmembrane protein 87A-like [N... 79 2e-11 ref|XP_008784333.1| PREDICTED: transmembrane protein 87B-like [P... 79 2e-11 ref|XP_004303710.1| PREDICTED: transmembrane protein 87A [Fragar... 79 2e-11 ref|XP_002271404.1| PREDICTED: transmembrane protein 87A [Vitis ... 79 2e-11 emb|CAN62240.1| hypothetical protein VITISV_033728 [Vitis vinifera] 79 2e-11 ref|XP_010261782.1| PREDICTED: transmembrane protein 87A-like [N... 78 3e-11 ref|XP_009788386.1| PREDICTED: transmembrane protein 87A-like [N... 78 3e-11 ref|XP_009622142.1| PREDICTED: transmembrane protein 87A [Nicoti... 78 3e-11 ref|XP_006361333.1| PREDICTED: transmembrane protein 87A-like [S... 78 3e-11 ref|XP_004252401.1| PREDICTED: transmembrane protein 87A-like [S... 78 3e-11 ref|XP_010932393.1| PREDICTED: uncharacterized protein C26H5.07c... 78 3e-11 ref|XP_010932392.1| PREDICTED: transmembrane protein 87B-like is... 78 3e-11 gb|KJB79959.1| hypothetical protein B456_013G074700, partial [Go... 77 6e-11 ref|XP_012444397.1| PREDICTED: transmembrane protein 87A-like [G... 77 6e-11 gb|KHG18955.1| Transmembrane 87A [Gossypium arboreum] 77 6e-11 ref|XP_010111988.1| Transmembrane protein 87A [Morus notabilis] ... 77 8e-11 ref|XP_011659613.1| PREDICTED: transmembrane protein 87B isoform... 77 8e-11 ref|XP_011012016.1| PREDICTED: transmembrane protein 87A-like [P... 77 8e-11 >ref|XP_012831211.1| PREDICTED: transmembrane protein 87A-like [Erythranthe guttatus] gi|604347739|gb|EYU45894.1| hypothetical protein MIMGU_mgv1a004785mg [Erythranthe guttata] Length = 510 Score = 79.7 bits (195), Expect = 9e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 1732 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNST 1845 VY++ WQ AWIIPAFWQVLSFSVLCVICALWAPSQNST Sbjct: 416 VYNEHWQNAWIIPAFWQVLSFSVLCVICALWAPSQNST 453 >ref|XP_012856789.1| PREDICTED: transmembrane protein 87A [Erythranthe guttatus] gi|604301714|gb|EYU21300.1| hypothetical protein MIMGU_mgv1a020482mg [Erythranthe guttata] Length = 508 Score = 79.3 bits (194), Expect = 1e-11 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +1 Query: 1732 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNST 1845 VY+++WQ AWIIPAFWQVLSFSVLC+ICALWAPSQNST Sbjct: 415 VYNEQWQKAWIIPAFWQVLSFSVLCIICALWAPSQNST 452 >ref|XP_010273861.1| PREDICTED: transmembrane protein 87A-like [Nelumbo nucifera] Length = 508 Score = 79.0 bits (193), Expect = 2e-11 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = +1 Query: 1732 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNST 1845 VY++RWQ+AWIIPAFWQ+LSFS+LCVIC LWAPSQNST Sbjct: 414 VYNERWQSAWIIPAFWQILSFSLLCVICVLWAPSQNST 451 >ref|XP_008784333.1| PREDICTED: transmembrane protein 87B-like [Phoenix dactylifera] Length = 527 Score = 79.0 bits (193), Expect = 2e-11 Identities = 33/37 (89%), Positives = 37/37 (100%) Frame = +1 Query: 1732 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNS 1842 VY++RWQ+AWIIPAFWQVLSFS+LCVICALWAPSQNS Sbjct: 428 VYNERWQSAWIIPAFWQVLSFSLLCVICALWAPSQNS 464 >ref|XP_004303710.1| PREDICTED: transmembrane protein 87A [Fragaria vesca subsp. vesca] Length = 502 Score = 79.0 bits (193), Expect = 2e-11 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +1 Query: 1732 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNST 1845 VY+++WQ AWIIPAFWQVLSFS+LCVICALWAPSQNST Sbjct: 407 VYNEQWQNAWIIPAFWQVLSFSLLCVICALWAPSQNST 444 >ref|XP_002271404.1| PREDICTED: transmembrane protein 87A [Vitis vinifera] gi|297742979|emb|CBI35846.3| unnamed protein product [Vitis vinifera] Length = 510 Score = 79.0 bits (193), Expect = 2e-11 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +1 Query: 1732 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNST 1845 VY+++WQ AWIIPAFWQVLSFS+LCVICALWAPSQNST Sbjct: 416 VYNEQWQNAWIIPAFWQVLSFSLLCVICALWAPSQNST 453 >emb|CAN62240.1| hypothetical protein VITISV_033728 [Vitis vinifera] Length = 510 Score = 79.0 bits (193), Expect = 2e-11 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +1 Query: 1732 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNST 1845 VY+++WQ AWIIPAFWQVLSFS+LCVICALWAPSQNST Sbjct: 416 VYNEQWQNAWIIPAFWQVLSFSLLCVICALWAPSQNST 453 >ref|XP_010261782.1| PREDICTED: transmembrane protein 87A-like [Nelumbo nucifera] Length = 509 Score = 78.2 bits (191), Expect = 3e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +1 Query: 1732 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNST 1845 VY++RWQ AWIIPAFWQVLSFS+LCVICALWAPS NST Sbjct: 415 VYNERWQKAWIIPAFWQVLSFSLLCVICALWAPSHNST 452 >ref|XP_009788386.1| PREDICTED: transmembrane protein 87A-like [Nicotiana sylvestris] Length = 507 Score = 78.2 bits (191), Expect = 3e-11 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = +1 Query: 1732 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNS 1842 VY++RWQ AWIIPAFWQVLSFS+LC+ICALWAPSQNS Sbjct: 415 VYNERWQNAWIIPAFWQVLSFSLLCIICALWAPSQNS 451 >ref|XP_009622142.1| PREDICTED: transmembrane protein 87A [Nicotiana tomentosiformis] Length = 507 Score = 78.2 bits (191), Expect = 3e-11 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = +1 Query: 1732 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNS 1842 VY++RWQ AWIIPAFWQVLSFS+LC+ICALWAPSQNS Sbjct: 415 VYNERWQNAWIIPAFWQVLSFSLLCIICALWAPSQNS 451 >ref|XP_006361333.1| PREDICTED: transmembrane protein 87A-like [Solanum tuberosum] Length = 512 Score = 78.2 bits (191), Expect = 3e-11 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +1 Query: 1732 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNS 1842 VY++RWQ AWIIPAFWQVLSFS+LCVICALWAPSQNS Sbjct: 418 VYNERWQKAWIIPAFWQVLSFSLLCVICALWAPSQNS 454 >ref|XP_004252401.1| PREDICTED: transmembrane protein 87A-like [Solanum lycopersicum] Length = 512 Score = 78.2 bits (191), Expect = 3e-11 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +1 Query: 1732 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNS 1842 VY++RWQ AWIIPAFWQVLSFS+LCVICALWAPSQNS Sbjct: 418 VYNERWQKAWIIPAFWQVLSFSLLCVICALWAPSQNS 454 >ref|XP_010932393.1| PREDICTED: uncharacterized protein C26H5.07c-like isoform X2 [Elaeis guineensis] Length = 487 Score = 77.8 bits (190), Expect = 3e-11 Identities = 32/37 (86%), Positives = 37/37 (100%) Frame = +1 Query: 1732 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNS 1842 VY++RWQ+AWIIPAFWQVLSFS+LCVIC+LWAPSQNS Sbjct: 389 VYNERWQSAWIIPAFWQVLSFSLLCVICSLWAPSQNS 425 >ref|XP_010932392.1| PREDICTED: transmembrane protein 87B-like isoform X1 [Elaeis guineensis] Length = 526 Score = 77.8 bits (190), Expect = 3e-11 Identities = 32/37 (86%), Positives = 37/37 (100%) Frame = +1 Query: 1732 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNS 1842 VY++RWQ+AWIIPAFWQVLSFS+LCVIC+LWAPSQNS Sbjct: 428 VYNERWQSAWIIPAFWQVLSFSLLCVICSLWAPSQNS 464 >gb|KJB79959.1| hypothetical protein B456_013G074700, partial [Gossypium raimondii] Length = 129 Score = 77.0 bits (188), Expect = 6e-11 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +1 Query: 1732 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNST 1845 VY+++WQ AWIIPAFWQ+LSFS+LCVIC LWAPSQNST Sbjct: 33 VYNEQWQNAWIIPAFWQILSFSLLCVICVLWAPSQNST 70 >ref|XP_012444397.1| PREDICTED: transmembrane protein 87A-like [Gossypium raimondii] gi|763790034|gb|KJB57030.1| hypothetical protein B456_009G145600 [Gossypium raimondii] Length = 512 Score = 77.0 bits (188), Expect = 6e-11 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +1 Query: 1732 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNST 1845 VY+++WQ AWIIPAFWQ+LSFS+LCVIC LWAPSQNST Sbjct: 416 VYNEQWQNAWIIPAFWQILSFSLLCVICVLWAPSQNST 453 >gb|KHG18955.1| Transmembrane 87A [Gossypium arboreum] Length = 507 Score = 77.0 bits (188), Expect = 6e-11 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +1 Query: 1732 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNST 1845 VY+++WQ AWIIPAFWQ+LSFS+LCVIC LWAPSQNST Sbjct: 411 VYNEQWQNAWIIPAFWQILSFSLLCVICVLWAPSQNST 448 >ref|XP_010111988.1| Transmembrane protein 87A [Morus notabilis] gi|587945930|gb|EXC32299.1| Transmembrane protein 87A [Morus notabilis] Length = 508 Score = 76.6 bits (187), Expect = 8e-11 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = +1 Query: 1732 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNS 1842 +Y+++WQ AWIIPAFWQVLSFS+LCVICALWAPSQNS Sbjct: 413 IYNEQWQNAWIIPAFWQVLSFSLLCVICALWAPSQNS 449 >ref|XP_011659613.1| PREDICTED: transmembrane protein 87B isoform X2 [Cucumis sativus] Length = 462 Score = 76.6 bits (187), Expect = 8e-11 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = +1 Query: 1732 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNS 1842 +Y+++WQ AWIIPAFWQVLSFS+LCVICALWAPSQNS Sbjct: 366 IYNEQWQNAWIIPAFWQVLSFSLLCVICALWAPSQNS 402 >ref|XP_011012016.1| PREDICTED: transmembrane protein 87A-like [Populus euphratica] Length = 509 Score = 76.6 bits (187), Expect = 8e-11 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = +1 Query: 1732 VYSKRWQTAWIIPAFWQVLSFSVLCVICALWAPSQNS 1842 VY++RWQ AW+IPAFW+VLSFS+LCVICALWAPSQNS Sbjct: 414 VYNERWQNAWVIPAFWRVLSFSLLCVICALWAPSQNS 450